Recombinant Human DNASE1L3

Cat.No. : DNASE1L3-26157TH
Product Overview : Recombinant Human DNASE1L3 (51 a.a. - 150 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene encodes a member of the deoxyribonuclease I family. The encoded protein hydrolyzes DNA, is not inhibited by actin, and mediates the breakdown of DNA during apoptosis. Mutations in this gene are a cause of systemic lupus erythematosus-16. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Molecular Mass : 36.63 kDa
AA Sequence : RCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDG DADVFSREPFVVWFQSPHTAVKDFV
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DNASE1L3 deoxyribonuclease I-like 3 [ Homo sapiens (human) ]
Official Symbol DNASE1L3
Synonyms DNASE1L3; deoxyribonuclease I-like 3; DNase I homolog protein 2; DNase I homolog protein DHP2; DNase I-like 3; DNase gamma; LS-DNase; Liver and spleen DNase; deoxyribonuclease I-like III; deoxyribonuclease gamma; DHP2, DNAS1L3; EC 3.1.21.-
Gene ID 1776
mRNA Refseq NM_004944
Protein Refseq NP_004935
MIM 602244
UniProt ID Q13609
Chromosome Location 3p14.3
Function DNA binding; calcium ion binding; deoxyribonuclease activity; endodeoxyribonuclease activity; endodeoxyribonuclease activity, producing 5''-phosphomonoesters

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNASE1L3 Products

Required fields are marked with *

My Review for All DNASE1L3 Products

Required fields are marked with *

0
cart-icon
0
compare icon