Recombinant Human DNASE1L3
| Cat.No. : | DNASE1L3-26157TH |
| Product Overview : | Recombinant Human DNASE1L3 (51 a.a. - 150 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | This gene encodes a member of the deoxyribonuclease I family. The encoded protein hydrolyzes DNA, is not inhibited by actin, and mediates the breakdown of DNA during apoptosis. Mutations in this gene are a cause of systemic lupus erythematosus-16. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | RCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDG DADVFSREPFVVWFQSPHTAVKDFV |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DNASE1L3 deoxyribonuclease I-like 3 [ Homo sapiens (human) ] |
| Official Symbol | DNASE1L3 |
| Synonyms | DNASE1L3; deoxyribonuclease I-like 3; DNase I homolog protein 2; DNase I homolog protein DHP2; DNase I-like 3; DNase gamma; LS-DNase; Liver and spleen DNase; deoxyribonuclease I-like III; deoxyribonuclease gamma; DHP2, DNAS1L3; EC 3.1.21.- |
| Gene ID | 1776 |
| mRNA Refseq | NM_004944 |
| Protein Refseq | NP_004935 |
| MIM | 602244 |
| UniProt ID | Q13609 |
| Chromosome Location | 3p14.3 |
| Function | DNA binding; calcium ion binding; deoxyribonuclease activity; endodeoxyribonuclease activity; endodeoxyribonuclease activity, producing 5''-phosphomonoesters |
| ◆ Recombinant Proteins | ||
| DNASE1L3-13HFL | Recombinant Human DNASE1L3 Protein, Full Length, N-GST and C-His tagged | +Inquiry |
| DNASE1L3-26157TH | Recombinant Human DNASE1L3 | +Inquiry |
| DNASE1L3-1535H | Recombinant Human DNASE1L3 Protein, GST-tagged | +Inquiry |
| DNASE1L3-29H | Recombinant Human DNASE1L3 Full Length protein, His-tagged | +Inquiry |
| DNASE1L3-2268M | Recombinant Mouse DNASE1L3 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNASE1L3-6864HCL | Recombinant Human DNASE1L3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNASE1L3 Products
Required fields are marked with *
My Review for All DNASE1L3 Products
Required fields are marked with *



