Recombinant Human DNASE1L3 protein, His-tagged
| Cat.No. : | DNASE1L3-2964H |
| Product Overview : | Recombinant Human DNASE1L3 protein(1-305 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-305 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | DNASE1L3 deoxyribonuclease I-like 3 [ Homo sapiens ] |
| Official Symbol | DNASE1L3 |
| Synonyms | DNASE1L3; deoxyribonuclease I-like 3; deoxyribonuclease gamma; DNAS1L3; DNase gamma; LSD; LS-DNase; DNase I-like 3; Liver and spleen DNase; DNase I homolog protein 2; DNase I homolog protein DHP2; deoxyribonuclease I-like III; DHP2; SLEB16; |
| Gene ID | 1776 |
| mRNA Refseq | NM_001256560 |
| Protein Refseq | NP_001243489 |
| MIM | 602244 |
| UniProt ID | Q13609 |
| ◆ Recombinant Proteins | ||
| DNASE1L3-12097H | Recombinant Human DNASE1L3 protein, GST-tagged | +Inquiry |
| DNASE1L3-4729M | Recombinant Mouse DNASE1L3 Protein | +Inquiry |
| DNASE1L3-26157TH | Recombinant Human DNASE1L3 | +Inquiry |
| DNASE1L3-4417H | Recombinant Human DNASE1L3 protein | +Inquiry |
| DNASE1L3-12369Z | Recombinant Zebrafish DNASE1L3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNASE1L3-6864HCL | Recombinant Human DNASE1L3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNASE1L3 Products
Required fields are marked with *
My Review for All DNASE1L3 Products
Required fields are marked with *
