Recombinant Human DNM1L protein, GST-tagged
Cat.No. : | DNM1L-6744H |
Product Overview : | Recombinant Human DNM1L protein(69-142 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 69-142 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | HVSQEDKRKTTGEENGVEAEEWGKFLHTKNKLYTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | DNM1L dynamin 1-like [ Homo sapiens ] |
Official Symbol | DNM1L |
Synonyms | DNM1L; dynamin 1-like; dynamin-1-like protein; DRP1; DVLP; DYMPLE; HDYNIV; VPS1; dynamin-like protein 4; dynamin-like protein IV; Dnm1p/Vps1p-like protein; dynamin-related protein 1; dynamin family member proline-rich carboxyl-terminal domain less; DLP1; EMPF; DYNIV-11; FLJ41912; |
Gene ID | 10059 |
mRNA Refseq | NM_005690 |
Protein Refseq | NP_005681 |
MIM | 603850 |
UniProt ID | O00429 |
◆ Recombinant Proteins | ||
DNM1L-4736M | Recombinant Mouse DNM1L Protein | +Inquiry |
DNM1L-1923R | Recombinant Rat DNM1L Protein | +Inquiry |
DNM1L-4043HF | Recombinant Full Length Human DNM1L Protein, GST-tagged | +Inquiry |
DNM1L-2457H | Recombinant Human DNM1L protein(501-570 aa), C-His-tagged | +Inquiry |
DNM1L-2584H | Recombinant Human DNM1L Protein (1-710 aa), His-Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNM1L-6858HCL | Recombinant Human DNM1L 293 Cell Lysate | +Inquiry |
DNM1L-6859HCL | Recombinant Human DNM1L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNM1L Products
Required fields are marked with *
My Review for All DNM1L Products
Required fields are marked with *
0
Inquiry Basket