Recombinant Human DNM2, His-tagged
Cat.No. : | DNM2-26990TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 529-824 of Human Dynamin 2 with N terminal His tag. MWt 34kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 529-824 a.a. |
Description : | Dynamins represent one of the subfamilies of GTP-binding proteins. These proteins share considerable sequence similarity over the N-terminal portion of the molecule, which contains the GTPase domain. Dynamins are associated with microtubules. They have been implicated in cell processes such as endocytosis and cell motility, and in alterations of the membrane that accompany certain activities such as bone resorption by osteoclasts. Dynamins bind many proteins that bind actin and other cytoskeletal proteins. Dynamins can also self-assemble, a process that stimulates GTPase activity. Five alternatively spliced transcripts encoding different proteins have been described. Additional alternatively spliced transcripts may exist, but their full-length nature has not been determined. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 104 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | (Amino acid sequence (Sequence determined by 5 Sequencing))LMKGGSKEYWFVLTAESLSWYKDEEE KEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNV YKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDL MPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEES ADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPP PVDDTWLQSASSHSPTPQRRPVSSIHPPGRPPAVRGPTPG PPLIPVPVGAAASFSAPPIPSRPGPQSVFANSDLFPAP |
Gene Name | DNM2 dynamin 2 [ Homo sapiens ] |
Official Symbol | DNM2 |
Synonyms | DNM2; dynamin 2; dynamin-2; CMTDI1; CMTDIB; cytoskeletal protein; DI CMTB; DYN2; dynamin II; DYNII; |
Gene ID | 1785 |
mRNA Refseq | NM_001005360 |
Protein Refseq | NP_001005360 |
MIM | 602378 |
Uniprot ID | P50570 |
Chromosome Location | 19p |
Pathway | Arf6 trafficking events, organism-specific biosystem; Axon guidance, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Clathrin derived vesicle budding, organism-specific biosystem; |
Function | GTP binding; GTPase activity; GTPase activity; enzyme binding; hydrolase activity; |
◆ Recombinant Proteins | ||
DNM2-1924R | Recombinant Rat DNM2 Protein | +Inquiry |
DNM2-1132R | Recombinant Rhesus Macaque DNM2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNM2-2786H | Recombinant Human DNM2 Protein, GST-tagged | +Inquiry |
DNM2-26990TH | Recombinant Human DNM2, His-tagged | +Inquiry |
DNM2-17H | Recombinant Human DNM2, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNM2-6857HCL | Recombinant Human DNM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNM2 Products
Required fields are marked with *
My Review for All DNM2 Products
Required fields are marked with *