Recombinant Human DNMT3B
Cat.No. : | DNMT3B-26884TH |
Product Overview : | Recombinant fragment (amino acids 221-320) of Human Dnmt3b with a proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase which is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes primarily to the nucleus and its expression is developmentally regulated. Mutations in this gene cause the immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. Eight alternatively spliced transcript variants have been described. The full length sequences of variants 4 and 5 have not been determined. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Ubiquitous; highly expressed in fetal liver, heart, kidney, placenta, and at lower levels in spleen, colon, brain, liver, small intestine, lung, peripheral blood mononuclear cells, and skeletal muscle. Isoform 1 is expressed in all tissues except brain, s |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSS |
Sequence Similarities : | Belongs to the C5-methyltransferase family.Contains 1 ADD domain.Contains 1 GATA-type zinc finger.Contains 1 PHD-type zinc finger.Contains 1 PWWP domain. |
Gene Name | DNMT3B DNA (cytosine-5-)-methyltransferase 3 beta [ Homo sapiens ] |
Official Symbol | DNMT3B |
Synonyms | DNMT3B; DNA (cytosine-5-)-methyltransferase 3 beta; DNA (cytosine-5)-methyltransferase 3B; |
Gene ID | 1789 |
mRNA Refseq | NM_175849 |
Protein Refseq | NP_787045 |
MIM | 602900 |
Uniprot ID | Q9UBC3 |
Chromosome Location | 20q11.2 |
Pathway | Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Methionine degradation, organism-specific biosystem; Methionine degradation, conserved biosystem; |
Function | DNA (cytosine-5-)-methyltransferase activity; DNA (cytosine-5-)-methyltransferase activity; DNA (cytosine-5-)-methyltransferase activity; DNA (cytosine-5-)-methyltransferase activity, acting on CpG substrates; DNA binding; |
◆ Recombinant Proteins | ||
DNMT3B-1360H | Recombinant Human DNMT3B Protein, His&GST-tagged | +Inquiry |
Dnmt3b-2622M | Recombinant Mouse Dnmt3b Protein, Myc/DDK-tagged | +Inquiry |
DNMT3B-2680Z | Recombinant Zebrafish DNMT3B | +Inquiry |
DNMT3B-780H | Recombinant Human DNMT3B Protein, His (Fc)-Avi-tagged | +Inquiry |
DNMT3B-74H | Recombinant Human DNMT3B protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNMT3B-6854HCL | Recombinant Human DNMT3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNMT3B Products
Required fields are marked with *
My Review for All DNMT3B Products
Required fields are marked with *