Recombinant Human DNMT3B

Cat.No. : DNMT3B-26884TH
Product Overview : Recombinant fragment (amino acids 221-320) of Human Dnmt3b with a proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase which is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes primarily to the nucleus and its expression is developmentally regulated. Mutations in this gene cause the immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. Eight alternatively spliced transcript variants have been described. The full length sequences of variants 4 and 5 have not been determined.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Ubiquitous; highly expressed in fetal liver, heart, kidney, placenta, and at lower levels in spleen, colon, brain, liver, small intestine, lung, peripheral blood mononuclear cells, and skeletal muscle. Isoform 1 is expressed in all tissues except brain, s
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWFGDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAGKTFPSS
Sequence Similarities : Belongs to the C5-methyltransferase family.Contains 1 ADD domain.Contains 1 GATA-type zinc finger.Contains 1 PHD-type zinc finger.Contains 1 PWWP domain.
Gene Name DNMT3B DNA (cytosine-5-)-methyltransferase 3 beta [ Homo sapiens ]
Official Symbol DNMT3B
Synonyms DNMT3B; DNA (cytosine-5-)-methyltransferase 3 beta; DNA (cytosine-5)-methyltransferase 3B;
Gene ID 1789
mRNA Refseq NM_175849
Protein Refseq NP_787045
MIM 602900
Uniprot ID Q9UBC3
Chromosome Location 20q11.2
Pathway Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Methionine degradation, organism-specific biosystem; Methionine degradation, conserved biosystem;
Function DNA (cytosine-5-)-methyltransferase activity; DNA (cytosine-5-)-methyltransferase activity; DNA (cytosine-5-)-methyltransferase activity; DNA (cytosine-5-)-methyltransferase activity, acting on CpG substrates; DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNMT3B Products

Required fields are marked with *

My Review for All DNMT3B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon