Recombinant Human DOCK1
| Cat.No. : | DOCK1-26153TH |
| Product Overview : | Recombinant full length Human DOCK1 with N-terminal proprietary tag, 42.79 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 152 amino acids |
| Description : | This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis. |
| Molecular Weight : | 42.790kDa inclusive of tags |
| Tissue specificity : | Highly expressed in placenta, lung, kidney, pancreas and ovary. Expressed at intermediate level in thymus, testes and colon. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MRIGRQSCKIHNYAINNGLFFKCMISPPSGDVRNDIYVTL VQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGD EAISEYKSVIYYQVKQPRWFETVKVLFTWSFYHMALIMKC SFVTQGNILTSSSARELLQAGRVSPNKVIQGC |
| Sequence Similarities : | Belongs to the DOCK family.Contains 1 DHR-1 (CZH-1) domain.Contains 1 DHR-2 (CZH-2) domain.Contains 1 SH3 domain. |
| Gene Name | DOCK1 dedicator of cytokinesis 1 [ Homo sapiens ] |
| Official Symbol | DOCK1 |
| Synonyms | DOCK1; dedicator of cytokinesis 1; dedicator of cyto kinesis 1; dedicator of cytokinesis protein 1; ced5; DOCK180; DOwnstream of CrK; |
| Gene ID | 1793 |
| mRNA Refseq | NM_001380 |
| Protein Refseq | NP_001371 |
| MIM | 601403 |
| Uniprot ID | Q14185 |
| Chromosome Location | 10q26.13-q26.3 |
| Pathway | Axon guidance, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; DCC mediated attractive signaling, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
| Function | GTP binding; GTPase activator activity; GTPase binding; SH3 domain binding; guanyl-nucleotide exchange factor activity; |
| ◆ Recombinant Proteins | ||
| DOCK1-1980H | Recombinant Human DOCK1 Protein (Arg443-Cys627), N-His tagged | +Inquiry |
| DOCK1-6085Z | Recombinant Zebrafish DOCK1 | +Inquiry |
| DOCK1-2802H | Recombinant Human DOCK1 Protein, GST-tagged | +Inquiry |
| DOCK1-4068HF | Recombinant Full Length Human DOCK1 Protein, GST-tagged | +Inquiry |
| DOCK1-126HF | Recombinant Full Length Human DOCK1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DOCK1 Products
Required fields are marked with *
My Review for All DOCK1 Products
Required fields are marked with *




