Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human DOCK1

Cat.No. : DOCK1-26951TH
Product Overview : Recombinant fragment of Human DOCK1 (aa 698-803) with N-terminal proprietary tag, 37.29 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis.
Protein length : 106 amino acids
Molecular Weight : 37.290kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Highly expressed in placenta, lung, kidney, pancreas and ovary. Expressed at intermediate level in thymus, testes and colon.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYK AMKALESIFKFIVRSRILFNQLYENKGEADFVESLLQLFR SINDMMSSMSDQTVRVKGAALKYLPT
Sequence Similarities : Belongs to the DOCK family.Contains 1 DHR-1 (CZH-1) domain.Contains 1 DHR-2 (CZH-2) domain.Contains 1 SH3 domain.
Gene Name : DOCK1 dedicator of cytokinesis 1 [ Homo sapiens ]
Official Symbol : DOCK1
Synonyms : DOCK1; dedicator of cytokinesis 1; dedicator of cyto kinesis 1; dedicator of cytokinesis protein 1; ced5; DOCK180; DOwnstream of CrK;
Gene ID : 1793
mRNA Refseq : NM_001380
Protein Refseq : NP_001371
MIM : 601403
Uniprot ID : Q14185
Chromosome Location : 10q26.13-q26.3
Pathway : Axon guidance, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; DCC mediated attractive signaling, organism-specific biosystem; Developmental Biology, organism-specific biosystem;
Function : GTP binding; GTPase activator activity; GTPase binding; SH3 domain binding; guanyl-nucleotide exchange factor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends