Recombinant Human DOCK1 protein, His-tagged
Cat.No. : | DOCK1-2543H |
Product Overview : | Recombinant Human DOCK1 protein(1565-1865 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1565-1865 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | KDLIAWQIPFLAEGIRIHGDKVTEALRPFHERMEACFKQLKEKVEKEYGVRIMPSSLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSLSSDSTPSRPGSDGFALEPLLPKKMHSRSQDKLDKDDLEKEKKDKKKEKRNSKHQEIFEKEFKPTDISLQQSEAVILSETISPLRPQRPKSQVMNVIGSERRFSVSPSSPSSQQTPPPVTPRAKLSFSMQSSLELNGMTGADVADVPPPLPLKGSVADYGNLMENQDLLGSPTPPPPPPHQRHLPPPLPSKTPPPPPPKTTRKQTSVDSGIVQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DOCK1 dedicator of cytokinesis 1 [ Homo sapiens ] |
Official Symbol | DOCK1 |
Synonyms | DOCK1; dedicator of cytokinesis 1; dedicator of cyto kinesis 1; dedicator of cytokinesis protein 1; ced5; DOCK180; DOwnstream of CrK; dedicator of cyto-kinesis 1; 180 kDa protein downstream of CRK; |
Gene ID | 1793 |
mRNA Refseq | NM_001380 |
Protein Refseq | NP_001371 |
MIM | 601403 |
UniProt ID | Q14185 |
◆ Recombinant Proteins | ||
DOCK1-4068HF | Recombinant Full Length Human DOCK1 Protein, GST-tagged | +Inquiry |
DOCK1-6085Z | Recombinant Zebrafish DOCK1 | +Inquiry |
DOCK1-26951TH | Recombinant Human DOCK1 | +Inquiry |
DOCK1-1980H | Recombinant Human DOCK1 Protein (Arg443-Cys627), N-His tagged | +Inquiry |
DOCK1-26153TH | Recombinant Human DOCK1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DOCK1 Products
Required fields are marked with *
My Review for All DOCK1 Products
Required fields are marked with *
0
Inquiry Basket