Recombinant Human DOK2 Protein, GST-tagged
| Cat.No. : | DOK2-2810H |
| Product Overview : | Human DOK2 full-length ORF ( AAH32623, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase. It may be a critical substrate for p210(bcr/abl), a chimeric protein whose presence is associated with CML. This encoded protein binds p120 (RasGAP) from CML cells. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 71.06 kDa |
| AA Sequence : | MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCGAARKVIRLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFPGQRKELSGPEGKQSRPCMEENELYSSAVTVGPHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNAAPATPQPQPATIPASLPRPDSPYSRPHDSLPPPSPTTPVPAPRPRGQEGEYAVPFDAVARSLGKNFRGILAVPPQLLADPLYDSIEETLPPRPDHIYDEPEGVAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DOK2 docking protein 2, 56kDa [ Homo sapiens ] |
| Official Symbol | DOK2 |
| Synonyms | DOK2; docking protein 2, 56kDa; docking protein 2, 56kD; docking protein 2; Dok 2; p56dok 2; p56(dok-2); downstream of tyrosine kinase 2; p56DOK; p56dok-2; |
| Gene ID | 9046 |
| mRNA Refseq | NM_003974 |
| Protein Refseq | NP_003965 |
| MIM | 604997 |
| UniProt ID | O60496 |
| ◆ Recombinant Proteins | ||
| DOK2-2483M | Recombinant Mouse DOK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Dok2-2630M | Recombinant Mouse Dok2 Protein, Myc/DDK-tagged | +Inquiry |
| DOK2-1233H | Recombinant Human DOK2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DOK2-4761M | Recombinant Mouse DOK2 Protein | +Inquiry |
| DOK2-3938HF | Recombinant Full Length Human DOK2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DOK2-6847HCL | Recombinant Human DOK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DOK2 Products
Required fields are marked with *
My Review for All DOK2 Products
Required fields are marked with *
