Recombinant Human DPEP2 protein, His-tagged
Cat.No. : | DPEP2-4671H |
Product Overview : | Recombinant Human DPEP2 protein(Q9H4A9)(33-463 aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 33-463 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 50.5 kDa |
AASequence : | AYTTPGPPRALTTLGAPRAHTMPGTYAPSTTLSSPSTQGLQEQARALMRDFPLVDGHNDLPLVLRQVYQKGLQDVNLRNFSYGQTSLDRLRDGLVGAQFWSAYVPCQTQDRDALRLTLEQIDLIRRMCASYSELELVTSAKALNDTQKLACLIGVEGGHSLDNSLSILRTFYMLGVRYLTLTHTCNTPWAESSAKGVHSFYNNISGLTDFGEKVVAEMNRLGMMVDLSHVSDAVARRALEVSQAPVIFSHSAARGVCNSARNVPDDILQLLKKNGGVVMVSLSMGVIQCNPSANVSTVADHFDHIKAVIGSKFIGIGGDYDGAGKFPQGLEDVSTYPVLIEELLSRGWSEEELQGVLRGNLLRVFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQELTEIPIHWTAKLPAKWSVS |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | DPEP2 dipeptidase 2 [ Homo sapiens ] |
Official Symbol | DPEP2 |
Synonyms | DPEP2; dipeptidase 2; MBD2; |
Gene ID | 64174 |
mRNA Refseq | NM_022355 |
Protein Refseq | NP_071750 |
MIM | 609925 |
UniProt ID | Q9H4A9 |
◆ Recombinant Proteins | ||
DPEP2-2350H | Recombinant Human DPEP2 protein, His-tagged | +Inquiry |
DPEP2-12137H | Recombinant Human DPEP2, GST-tagged | +Inquiry |
DPEP2-2205H | Recombinant Human DPEP2 Protein (Leu303-Leu486), His tagged | +Inquiry |
DPEP2-2824H | Recombinant Human DPEP2 Protein, GST-tagged | +Inquiry |
DPEP2-4009HF | Recombinant Full Length Human DPEP2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPEP2-1177HCL | Recombinant Human DPEP2 cell lysate | +Inquiry |
DPEP2-1162HCL | Recombinant Human DPEP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPEP2 Products
Required fields are marked with *
My Review for All DPEP2 Products
Required fields are marked with *