Recombinant Human DPM1 Protein, His-Tagged
Cat.No. : | DPM1-01H |
Product Overview : | Recombinant Human DPM1 Protein, His-tagged was expressed in E.coli cell |
Availability | July 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. Human DPM1 lacks a carboxy-terminal transmembrane domain and signal sequence and is regulated by DPM2. Mutations in this gene are associated with congenital disorder of glycosylation type Ie. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | The protein has a calculated MW of 30.45 kDa. |
AA Sequence : | HHHHHHMASLEVSRSPRRSR RELEVRSPRQ NKYSVLLPTYNERENLPLIV WLLVKSFSESGINYEIIIID DGSPDGTRDVAEQLEKIYGSDRILLRPREK KLGLGTAYIHGMKHATGNYIIIMDADLSHHPKFIPEFIRKQKEGNFDIVS GTRYKGNGGVYGWDLKRKIISRGANFLTQILLRPGASDLTGSFRLYRKEV LEKLIEKCVSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESKLGGN EIVSFLKGLLTLFATT |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.4 mg/mL |
Storage Buffer : | PBS, pH 7.4 |
Gene Name | DPM1 dolichyl-phosphate mannosyltransferase subunit 1, catalytic [ Homo sapiens (human) ] |
Official Symbol | DPM1 |
Synonyms | MPDS; CDGIE |
Gene ID | 8813 |
mRNA Refseq | NM_001317034.1 |
Protein Refseq | NP_001303963.1 |
MIM | 603503 |
UniProt ID | O60762 |
◆ Cell & Tissue Lysates | ||
DPM1-6835HCL | Recombinant Human DPM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPM1 Products
Required fields are marked with *
My Review for All DPM1 Products
Required fields are marked with *