Recombinant Human DPYD
Cat.No. : | DPYD-28437TH |
Product Overview : | Recombinant fragment of Human DPYD with N terminal proprietary tag, 37.73kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a pyrimidine catabolic enzyme and the initial and rate-limiting factor in the pathway of uracil and thymidine catabolism. Mutations in this gene result in dihydropyrimidine dehydrogenase deficiency, an error in pyrimidine metabolism associated with thymine-uraciluria and an increased risk of toxicity in cancer patients receiving 5-fluorouracil chemotherapy. Two transcript variants encoding different isoforms have been found for this gene. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Found in most tissues with greatest activity found in liver and peripheral blood mononuclear cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKH WKRNPDKNCFNCEKLENNFDDIKHTTLGERGALREAMRCL KCADAPCQKSCPTNLDIKSFITSIANKNYY |
Sequence Similarities : | Belongs to the dihydropyrimidine dehydrogenase family.Contains 3 4Fe-4S ferredoxin-type domains. |
Gene Name : | DPYD dihydropyrimidine dehydrogenase [ Homo sapiens ] |
Official Symbol : | DPYD |
Synonyms : | DPYD; dihydropyrimidine dehydrogenase; dihydropyrimidine dehydrogenase [NADP+]; DPD; |
Gene ID : | 1806 |
mRNA Refseq : | NM_000110 |
Protein Refseq : | NP_000101 |
MIM : | 612779 |
Uniprot ID : | Q12882 |
Chromosome Location : | 1p22 |
Pathway : | Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; |
Function : | 4 iron, 4 sulfur cluster binding; NADP binding; dihydroorotate oxidase activity; dihydropyrimidine dehydrogenase (NADP+) activity; dihydropyrimidine dehydrogenase (NADP+) activity; |
Products Types
◆ Recombinant Protein | ||
DPYD-786H | Recombinant Human DPYD Protein, His (Fc)-Avi-tagged | +Inquiry |
DPYD-1606R | Recombinant Rat DPYD Protein, His (Fc)-Avi-tagged | +Inquiry |
DPYD-2860H | Recombinant Human DPYD Protein, GST-tagged | +Inquiry |
Dpyd-2649M | Recombinant Mouse Dpyd Protein, Myc/DDK-tagged | +Inquiry |
DPYD-2518M | Recombinant Mouse DPYD Protein, His (Fc)-Avi-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket