Recombinant Human DPYD

Cat.No. : DPYD-28437TH
Product Overview : Recombinant fragment of Human DPYD with N terminal proprietary tag, 37.73kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : The protein encoded by this gene is a pyrimidine catabolic enzyme and the initial and rate-limiting factor in the pathway of uracil and thymidine catabolism. Mutations in this gene result in dihydropyrimidine dehydrogenase deficiency, an error in pyrimidine metabolism associated with thymine-uraciluria and an increased risk of toxicity in cancer patients receiving 5-fluorouracil chemotherapy. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Found in most tissues with greatest activity found in liver and peripheral blood mononuclear cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKH WKRNPDKNCFNCEKLENNFDDIKHTTLGERGALREAMRCL KCADAPCQKSCPTNLDIKSFITSIANKNYY
Sequence Similarities : Belongs to the dihydropyrimidine dehydrogenase family.Contains 3 4Fe-4S ferredoxin-type domains.
Gene Name DPYD dihydropyrimidine dehydrogenase [ Homo sapiens ]
Official Symbol DPYD
Synonyms DPYD; dihydropyrimidine dehydrogenase; dihydropyrimidine dehydrogenase [NADP+]; DPD;
Gene ID 1806
mRNA Refseq NM_000110
Protein Refseq NP_000101
MIM 612779
Uniprot ID Q12882
Chromosome Location 1p22
Pathway Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function 4 iron, 4 sulfur cluster binding; NADP binding; dihydroorotate oxidase activity; dihydropyrimidine dehydrogenase (NADP+) activity; dihydropyrimidine dehydrogenase (NADP+) activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DPYD Products

Required fields are marked with *

My Review for All DPYD Products

Required fields are marked with *

0
cart-icon