Recombinant Human DPYD
Cat.No. : | DPYD-28437TH |
Product Overview : | Recombinant fragment of Human DPYD with N terminal proprietary tag, 37.73kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | The protein encoded by this gene is a pyrimidine catabolic enzyme and the initial and rate-limiting factor in the pathway of uracil and thymidine catabolism. Mutations in this gene result in dihydropyrimidine dehydrogenase deficiency, an error in pyrimidine metabolism associated with thymine-uraciluria and an increased risk of toxicity in cancer patients receiving 5-fluorouracil chemotherapy. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Found in most tissues with greatest activity found in liver and peripheral blood mononuclear cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKH WKRNPDKNCFNCEKLENNFDDIKHTTLGERGALREAMRCL KCADAPCQKSCPTNLDIKSFITSIANKNYY |
Sequence Similarities : | Belongs to the dihydropyrimidine dehydrogenase family.Contains 3 4Fe-4S ferredoxin-type domains. |
Gene Name | DPYD dihydropyrimidine dehydrogenase [ Homo sapiens ] |
Official Symbol | DPYD |
Synonyms | DPYD; dihydropyrimidine dehydrogenase; dihydropyrimidine dehydrogenase [NADP+]; DPD; |
Gene ID | 1806 |
mRNA Refseq | NM_000110 |
Protein Refseq | NP_000101 |
MIM | 612779 |
Uniprot ID | Q12882 |
Chromosome Location | 1p22 |
Pathway | Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; |
Function | 4 iron, 4 sulfur cluster binding; NADP binding; dihydroorotate oxidase activity; dihydropyrimidine dehydrogenase (NADP+) activity; dihydropyrimidine dehydrogenase (NADP+) activity; |
◆ Recombinant Proteins | ||
DPYD-1291H | Recombinant Human DPYD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DPYD-28435TH | Recombinant Human DPYD | +Inquiry |
DPYD-2518M | Recombinant Mouse DPYD Protein, His (Fc)-Avi-tagged | +Inquiry |
DPYD-2860H | Recombinant Human DPYD Protein, GST-tagged | +Inquiry |
Dpyd-2112M | Recombinant Mouse Dpyd protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPYD Products
Required fields are marked with *
My Review for All DPYD Products
Required fields are marked with *