Recombinant Human DSG4 Protein, GST-tagged
Cat.No. : | DSG4-2891H |
Product Overview : | Human DSG4 partial ORF ( NP_817123, 531 a.a. - 630 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the desmoglein subgroup of desmosomal cadherins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a transmembrane component of desmosomes and may play a role in cell-cell adhesion in epithelial cells. Mutations in the gene are associated with localized autosomal recessive hypotrichosis and monilethrix, characterized by impaired hair growth. [provided by RefSeq, May 2016] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | EPPGIADMWDVRSTNATSAILTAKQVLSPGFYEIPILVKDSYNRACELAQMVQLYACDCDDNHMCLDSGAAGIYTEDITGDTYGPVTEDQAGVSNVGLGP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DSG4 desmoglein 4 [ Homo sapiens ] |
Official Symbol | DSG4 |
Synonyms | DSG4; desmoglein 4; desmoglein-4; CDHF13; LAH; CDH family member 13; cadherin family member 13; CDGF13; |
Gene ID | 147409 |
mRNA Refseq | NM_001134453 |
Protein Refseq | NP_001127925 |
MIM | 607892 |
UniProt ID | Q86SJ6 |
◆ Recombinant Proteins | ||
DSG4-1621R | Recombinant Rat DSG4 Protein, His (Fc)-Avi-tagged | +Inquiry |
DSG4-001H | Recombinant Human desmoglein 4 Protein, His tagged | +Inquiry |
DSG4-12180H | Recombinant Human DSG4, GST-tagged | +Inquiry |
DSG4-1962R | Recombinant Rat DSG4 Protein | +Inquiry |
DSG4-4844M | Recombinant Mouse DSG4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DSG4-6806HCL | Recombinant Human DSG4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DSG4 Products
Required fields are marked with *
My Review for All DSG4 Products
Required fields are marked with *