Recombinant Human DUPD1 Protein, GST-tagged

Cat.No. : DUPD1-2917H
Product Overview : Human DUPD1 full-length ORF ( NP_001003892.1, 1 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DUPD1 (Dual Specificity Phosphatase And Pro Isomerase Domain Containing 1) is a Protein Coding gene. Diseases associated with DUPD1 include Cervix Carcinoma. GO annotations related to this gene include phosphatase activity and protein tyrosine/serine/threonine phosphatase activity. An important paralog of this gene is DUSP13.
Molecular Mass : 51.7 kDa
AA Sequence : MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQDGEEEDGREL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DUPD1 dual specificity phosphatase and pro isomerase domain containing 1 [ Homo sapiens ]
Official Symbol DUPD1
Synonyms DUPD1; dual specificity phosphatase and pro isomerase domain containing 1; dual specificity phosphatase DUPD1; DUSP27; dual specificity phosphatase 27; atypical dual-specific protein phosphatase; FMDSP;
Gene ID 338599
mRNA Refseq NM_001003892
Protein Refseq NP_001003892
UniProt ID Q68J44

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUPD1 Products

Required fields are marked with *

My Review for All DUPD1 Products

Required fields are marked with *

0
cart-icon