Recombinant Human DUPD1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DUPD1-6116H
• Product Overview: DUPD1 MS Standard C13 and N15-labeled recombinant protein (NP_001003892) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Dual specificity phosphatase able to dephosphorylate phosphotyrosine, phosphoserine and phosphothreonine residues, with a preference for phosphotyrosine as a substrate.
• Molecular Mass: 25.2 kDa
• AA Sequence: MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQDGEEEDGRELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DUPD1 dual specificity phosphatase and pro isomerase domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: DUPD1
• Synonyms: DUPD1; dual specificity phosphatase and pro isomerase domain containing 1; dual specificity phosphatase DUPD1; DUSP27; dual specificity phosphatase 27; atypical dual-specific protein phosphatase; FMDSP
• Gene ID: 338599
• mRNA Refseq: NM_001003892
• Protein Refseq: NP_001003892
• MIM: 618574
• UniProt ID: Q68J44