Recombinant Human DUPD1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DUPD1-6116H |
Product Overview : | DUPD1 MS Standard C13 and N15-labeled recombinant protein (NP_001003892) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Dual specificity phosphatase able to dephosphorylate phosphotyrosine, phosphoserine and phosphothreonine residues, with a preference for phosphotyrosine as a substrate. |
Molecular Mass : | 25.2 kDa |
AA Sequence : | MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQDGEEEDGRELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DUPD1 dual specificity phosphatase and pro isomerase domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | DUPD1 |
Synonyms | DUPD1; dual specificity phosphatase and pro isomerase domain containing 1; dual specificity phosphatase DUPD1; DUSP27; dual specificity phosphatase 27; atypical dual-specific protein phosphatase; FMDSP; |
Gene ID | 338599 |
mRNA Refseq | NM_001003892 |
Protein Refseq | NP_001003892 |
MIM | 618574 |
UniProt ID | Q68J44 |
◆ Recombinant Proteins | ||
DUPD1-6116H | Recombinant Human DUPD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DUPD1-4085HF | Recombinant Full Length Human DUPD1 Protein, GST-tagged | +Inquiry |
DUPD1-4869M | Recombinant Mouse DUPD1 Protein | +Inquiry |
DUPD1-3673Z | Recombinant Zebrafish DUPD1 | +Inquiry |
Dupd1-2677M | Recombinant Mouse Dupd1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUPD1-6789HCL | Recombinant Human DUPD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUPD1 Products
Required fields are marked with *
My Review for All DUPD1 Products
Required fields are marked with *