Recombinant Human DUSP1 protein, GST-tagged

Cat.No. : DUSP1-32H
Product Overview : Recombinant Human DUSP1(305 a.a. - 367 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 305-367 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 32.67 kDa
AA Sequence : LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name DUSP1 dual specificity phosphatase 1 [ Homo sapiens ]
Official Symbol DUSP1
Synonyms DUSP1; dual specificity phosphatase 1; PTPN10; dual specificity protein phosphatase 1; CL100; HVH1; MKP 1; MAP kinase phosphatase 1; protein-tyrosine phosphatase CL100; dual specificity protein phosphatase hVH1; serine/threonine specific protein phosphatase; mitogen-activated protein kinase phosphatase 1; MKP1; MKP-1;
Gene ID 1843
mRNA Refseq NM_004417
Protein Refseq NP_004408
MIM 600714
UniProt ID P28562
Chromosome Location 5q35.1
Pathway ATF-2 transcription factor network, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; Fc-epsilon receptor I signaling in mast cells, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUSP1 Products

Required fields are marked with *

My Review for All DUSP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon