Recombinant Human DUSP1 protein, GST-tagged
Cat.No. : | DUSP1-32H |
Product Overview : | Recombinant Human DUSP1(305 a.a. - 367 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 305-367 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 32.67 kDa |
AA Sequence : | LLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | DUSP1 dual specificity phosphatase 1 [ Homo sapiens ] |
Official Symbol | DUSP1 |
Synonyms | DUSP1; dual specificity phosphatase 1; PTPN10; dual specificity protein phosphatase 1; CL100; HVH1; MKP 1; MAP kinase phosphatase 1; protein-tyrosine phosphatase CL100; dual specificity protein phosphatase hVH1; serine/threonine specific protein phosphatase; mitogen-activated protein kinase phosphatase 1; MKP1; MKP-1; |
Gene ID | 1843 |
mRNA Refseq | NM_004417 |
Protein Refseq | NP_004408 |
MIM | 600714 |
UniProt ID | P28562 |
Chromosome Location | 5q35.1 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; Fc-epsilon receptor I signaling in mast cells, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; |
◆ Recombinant Proteins | ||
DUSP1-4874M | Recombinant Mouse DUSP1 Protein | +Inquiry |
DUSP1-32H | Recombinant Human DUSP1 protein, GST-tagged | +Inquiry |
DUSP1-2561M | Recombinant Mouse DUSP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DUSP1-01H | Recombinant Human DUSP1 protein, His-GST-tagged | +Inquiry |
DUSP1-1172R | Recombinant Rhesus Macaque DUSP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP1 Products
Required fields are marked with *
My Review for All DUSP1 Products
Required fields are marked with *