Recombinant Human DUSP11 Protein, GST-tagged

Cat.No. : DUSP11-2923H
Product Overview : Human DUSP11 full-length ORF ( NP_003575.1, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product is localized to the nucleus and binds directly to RNA and splicing factors, and thus it is suggested to participate in nuclear mRNA metabolism. [provided by RefSeq, Sep 2008]
Molecular Mass : 65.3 kDa
AA Sequence : MSQWHHPRSGWGRRRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKENKDNDKLIGVHCTHGLNRTGYLICRYLIDVEGVRPDDAIELFNRCRGHCLERQNYIEDLQNGPIRKNWNSSVPRSSDFEDSAHLMQPVHNKPVKQGPRYNLHQIQGHSAPRHFHTQTQSLQQSVRKFSENPHVYQRHHLPPPGPPGEDYSHRRYSWNVKPNASRAAQDRRRWYPYNYSRLSYPACWEWTQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DUSP11 dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) [ Homo sapiens ]
Official Symbol DUSP11
Synonyms DUSP11; dual specificity phosphatase 11 (RNA/RNP complex 1-interacting); RNA/RNP complex-1-interacting phosphatase; PIR1; RNA/RNP complex-interacting phosphatase; dual specificity protein phosphatase 11; serine/threonine specific protein phosphatase; phosphatase that interacts with RNA/RNP complex 1;
Gene ID 8446
mRNA Refseq NM_003584
Protein Refseq NP_003575
MIM 603092
UniProt ID O75319

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUSP11 Products

Required fields are marked with *

My Review for All DUSP11 Products

Required fields are marked with *

0
cart-icon