Recombinant Human DUX4 Protein, GST-tagged

• Cat.No.: DUX4-2958H
• Product Overview: Recombinant Human DUX4 protein(NP_001280727.1)(263-424 aa) was expressed in E.coli with a N-terminal GST tag.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 263-424 aa
• Description: This gene is located within a D4Z4 repeat array in the subtelomeric region of chromosome 4q. The D4Z4 repeat is polymorphic in length; a similar D4Z4 repeat array has been identified on chromosome 10. Each D4Z4 repeat unit has an open reading frame (named DUX4) that encodes two homeoboxes; the repeat-array and ORF is conserved in other mammals. The encoded protein has been reported to function as a transcriptional activator of paired-like homeodomain transcription factor 1 (PITX1; GeneID 5307). Contraction of the macrosatellite repeat causes autosomal dominant facioscapulohumeral muscular dystrophy (FSHD). Alternative splicing results in multiple transcript variants.
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Bio-activity: Not Tested
• AA Sequence: MPGKSREDRDPQRDGLPGPCAVAQPGPAQAGPQGQGVLAPPTSQGSPWWGWGRGPQVAGAAWEPQAGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL
• Endotoxin: Please contact the lab for more information.
• Purity: 65%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Applications: Blocking peptide
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.

Gene Information

• Gene Name: DUX4 double homeobox 4 [ Homo sapiens (human) ]
• Official Symbol: DUX4
• Synonyms: DUX4L
• Gene ID: 100288687
• mRNA Refseq: NM_001293798.3
• Protein Refseq: NP_001280727.1
• MIM: 606009
• UniProt ID: Q9UBX2