Recombinant Human DUX4 protein, His-tagged
Cat.No. : | DUX4-2873H |
Product Overview : | Recombinant Human DUX4 protein(Q9UBX2)(327-424aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 327-424aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
Molecular Mass : | 17.1 kDa |
AASequence : | AGAAPPPQPAPPDASASARQGQMQGIPAPSQALQEPAPWSALPCGLLLDELLASPEFLQQAQPLLETEAPGELEASEEAASLEAPLSEEEYRALLEEL |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | DUX4 double homeobox 4 [ Homo sapiens ] |
Official Symbol | DUX4 |
Synonyms | DUX4; double homeobox 4; double homeobox protein 4; double homeobox protein 10; double homeobox protein 4/10; double homeobox protein DUX10; DUX10; |
Gene ID | 22947 |
mRNA Refseq | NM_033178 |
Protein Refseq | NP_149418 |
MIM | 606009 |
UniProt ID | Q9UBX2 |
◆ Recombinant Proteins | ||
DUX4-2874H | Recombinant Human DUX4 protein, His-tagged | +Inquiry |
DUX4-5857H | Recombinant Human DUX4 protein, His-tagged | +Inquiry |
DUX4-2958H | Recombinant Human DUX4 Protein, GST-tagged | +Inquiry |
DUX4-4133HF | Recombinant Full Length Human DUX4 Protein, GST-tagged | +Inquiry |
DUX4-2873H | Recombinant Human DUX4 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUX4 Products
Required fields are marked with *
My Review for All DUX4 Products
Required fields are marked with *