Recombinant Human DYNLT1 Protein, GST-tagged
Cat.No. : | DYNLT1-2979H |
Product Overview : | Human DYNLT1 full-length ORF (BAG37971.1, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a component of the motor complex, cytoplasmic dynein, which transports cellular cargo along microtubules in the cell. The encoded protein regulates the length of primary cilia which are sensory organelles found on the surface of cells. The protein encoded by this gene interacts with viral proteins, like the minor capsid protein L2 of human papillomavirus, and is required for dynein-mediated delivery of the viral nucleic acid to the host nucleus. This protein interacts with oncogenic nucleoporins to disrupt gene regulation and cause leukemic transformation. Pseudogenes of this gene are present on chromosomes 4 and 17. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2014] |
Molecular Mass : | 38.83 kDa |
AA Sequence : | MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DYNLT1 dynein, light chain, Tctex-type 1 [ Homo sapiens ] |
Official Symbol | DYNLT1 |
Synonyms | DYNLT1; dynein, light chain, Tctex-type 1; t complex associated testis expressed 1 like 1 , TCTEL1; dynein light chain Tctex-type 1; T-complex testis-specific protein 1 homolog; t-complex-associated-testis-expressed 1-like 1; CW-1; TCTEL1; tctex-1; MGC111571; |
Gene ID | 6993 |
mRNA Refseq | NM_006519 |
Protein Refseq | NP_006510 |
MIM | 601554 |
UniProt ID | P63172 |
◆ Recombinant Proteins | ||
DYNLT1-12235H | Recombinant Human DYNLT1, GST-tagged | +Inquiry |
DYNLT1-4166HF | Recombinant Full Length Human DYNLT1 Protein, GST-tagged | +Inquiry |
DYNLT1-2979H | Recombinant Human DYNLT1 Protein, GST-tagged | +Inquiry |
DYNLT1-7195Z | Recombinant Zebrafish DYNLT1 | +Inquiry |
DYNLT1-1452H | Recombinant Human DYNLT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYNLT1-6754HCL | Recombinant Human DYNLT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DYNLT1 Products
Required fields are marked with *
My Review for All DYNLT1 Products
Required fields are marked with *