Recombinant Human DYNLT1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | DYNLT1-1452H |
| Product Overview : | DYNLT1 MS Standard C13 and N15-labeled recombinant protein (NP_006510) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a component of the motor complex, cytoplasmic dynein, which transports cellular cargo along microtubules in the cell. The encoded protein regulates the length of primary cilia which are sensory organelles found on the surface of cells. The protein encoded by this gene interacts with viral proteins, like the minor capsid protein L2 of human papillomavirus, and is required for dynein-mediated delivery of the viral nucleic acid to the host nucleus. This protein interacts with oncogenic nucleoporins to disrupt gene regulation and cause leukemic transformation. Pseudogenes of this gene are present on chromosomes 4 and 17. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Molecular Mass : | 12.3 kDa |
| AA Sequence : | MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | DYNLT1 dynein light chain Tctex-type 1 [ Homo sapiens (human) ] |
| Official Symbol | DYNLT1 |
| Synonyms | DYNLT1; dynein, light chain, Tctex-type 1; t complex associated testis expressed 1 like 1, TCTEL1; dynein light chain Tctex-type 1; T-complex testis-specific protein 1 homolog; t-complex-associated-testis-expressed 1-like 1; CW-1; TCTEL1; tctex-1; MGC111571; |
| Gene ID | 6993 |
| mRNA Refseq | NM_006519 |
| Protein Refseq | NP_006510 |
| MIM | 601554 |
| UniProt ID | P63172 |
| ◆ Recombinant Proteins | ||
| DYNLT1-4166HF | Recombinant Full Length Human DYNLT1 Protein, GST-tagged | +Inquiry |
| DYNLT1-2978H | Recombinant Human DYNLT1 Protein, His-tagged | +Inquiry |
| DYNLT1-1452H | Recombinant Human DYNLT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DYNLT1-7195Z | Recombinant Zebrafish DYNLT1 | +Inquiry |
| DYNLT1-12235H | Recombinant Human DYNLT1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DYNLT1-6754HCL | Recombinant Human DYNLT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DYNLT1 Products
Required fields are marked with *
My Review for All DYNLT1 Products
Required fields are marked with *
