Recombinant Human DYNLT1 Protein, His-tagged
Cat.No. : | DYNLT1-2978H |
Product Overview : | Human DYNLT1 (NP_006510, 1 a.a. - 113 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a component of the motor complex, cytoplasmic dynein, which transports cellular cargo along microtubules in the cell. The encoded protein regulates the length of primary cilia which are sensory organelles found on the surface of cells. The protein encoded by this gene interacts with viral proteins, like the minor capsid protein L2 of human papillomavirus, and is required for dynein-mediated delivery of the viral nucleic acid to the host nucleus. This protein interacts with oncogenic nucleoporins to disrupt gene regulation and cause leukemic transformation. Pseudogenes of this gene are present on chromosomes 4 and 17. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2014] |
Form : | Liquid |
Molecular Mass : | 14.6 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | 1 mg/mL |
Storage Buffer : | In 20 mM Tris-HCl, 0.1M NaCl, pH 8.0 (1 mM dithiothreitol, 30% glycerol) |
Gene Name | DYNLT1 dynein, light chain, Tctex-type 1 [ Homo sapiens ] |
Official Symbol | DYNLT1 |
Synonyms | DYNLT1; dynein, light chain, Tctex-type 1; t complex associated testis expressed 1 like 1 , TCTEL1; dynein light chain Tctex-type 1; T-complex testis-specific protein 1 homolog; t-complex-associated-testis-expressed 1-like 1; CW-1; TCTEL1; tctex-1; MGC111571; |
Gene ID | 6993 |
mRNA Refseq | NM_006519 |
Protein Refseq | NP_006510 |
MIM | 601554 |
UniProt ID | P63172 |
◆ Recombinant Proteins | ||
DYNLT1-7195Z | Recombinant Zebrafish DYNLT1 | +Inquiry |
DYNLT1-3518H | Recombinant Human Dynein, Light chain, Tctex-Type 1, His-tagged | +Inquiry |
DYNLT1-2978H | Recombinant Human DYNLT1 Protein, His-tagged | +Inquiry |
DYNLT1-1452H | Recombinant Human DYNLT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DYNLT1-4166HF | Recombinant Full Length Human DYNLT1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYNLT1-6754HCL | Recombinant Human DYNLT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DYNLT1 Products
Required fields are marked with *
My Review for All DYNLT1 Products
Required fields are marked with *
0
Inquiry Basket