Recombinant Human EBI3

Cat.No. : EBI3-28222TH
Product Overview : Recombinant Human EBI3 produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa. The EBI3 is purified by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells.
Form : Sterile Filtered White lyophilized (freeze-dried) powder. EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.
Bio-activity : Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody.
Molecular Mass : 23.3 kDa
AA Sequence : RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQ LFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYK RQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK.
Purity : Greater than 90% as determined by RP-HPLC and SDS-PAGE.
Stability : Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Reconstitution : It is recommended to reconstitute the lyophilized EBI3 in sterile 10mM Acetic acid not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Gene Name EBI3 Epstein-Barr virus induced 3 [ Homo sapiens (human) ]
Official Symbol EBI3
Synonyms EBI3; IL27B; IL-27B; Epstein-Barr virus induced 3; interleukin-27 subunit beta; IL27 subunit; IL35 subunit; cytokine receptor; IL-27 subunit beta; EBV-induced gene 3 protein; Epstein-Barr virus induced gene 3; epstein-Barr virus-induced gene 3 protein
Gene ID 10148
mRNA Refseq NM_005755
Protein Refseq NP_005746
MIM 605816
UniProt ID Q14213
Chromosome Location 19p13.3
Pathway IL27-mediated signaling events
Function cytokine activity; cytokine receptor activity; interleukin-27 receptor binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EBI3 Products

Required fields are marked with *

My Review for All EBI3 Products

Required fields are marked with *

0
cart-icon
0
compare icon