Recombinant Human EBI3
| Cat.No. : | EBI3-28222TH |
| Product Overview : | Recombinant Human EBI3 produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa. The EBI3 is purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Description : | This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol. |
| Bio-activity : | Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody. |
| Molecular Mass : | 23.3 kDa |
| AA Sequence : | RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQ LFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYK RQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK. |
| Purity : | Greater than 90% as determined by RP-HPLC and SDS-PAGE. |
| Stability : | Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. |
| Reconstitution : | It is recommended to reconstitute the lyophilized EBI3 in sterile 10mM Acetic acid not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
| Gene Name | EBI3 Epstein-Barr virus induced 3 [ Homo sapiens (human) ] |
| Official Symbol | EBI3 |
| Synonyms | EBI3; IL27B; IL-27B; Epstein-Barr virus induced 3; interleukin-27 subunit beta; IL27 subunit; IL35 subunit; cytokine receptor; IL-27 subunit beta; EBV-induced gene 3 protein; Epstein-Barr virus induced gene 3; epstein-Barr virus-induced gene 3 protein |
| Gene ID | 10148 |
| mRNA Refseq | NM_005755 |
| Protein Refseq | NP_005746 |
| MIM | 605816 |
| UniProt ID | Q14213 |
| Chromosome Location | 19p13.3 |
| Pathway | IL27-mediated signaling events |
| Function | cytokine activity; cytokine receptor activity; interleukin-27 receptor binding |
| ◆ Recombinant Proteins | ||
| EBI3-4958M | Recombinant Mouse EBI3 Protein | +Inquiry |
| EBI3-70M | Recombinant Macaque EBI3 subunit (IL-27/IL-35) Protein | +Inquiry |
| EBI3-256H | Active Recombinant Human EBI3/p28 protein, His-tagged | +Inquiry |
| EBI3-1674H | Recombinant Human EBI3 Protein (Arg21-Lys229), His tagged | +Inquiry |
| Ebi3-7931M | Recombinant Mouse Ebi3 protein, His & T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EBI3-240HCL | Recombinant Human EBI3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EBI3 Products
Required fields are marked with *
My Review for All EBI3 Products
Required fields are marked with *
