Recombinant Human ECT2 protein, His-tagged

Cat.No. : ECT2-2823H
Product Overview : Recombinant Human ECT2 protein(1-350 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability August 03, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-350 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MAENSVLTSTTGRTSLADSSIFDSKVTEISKENLLIGSTSYVEEEMPQIETRVILVQEAGKQEELIKALKDIKVGFVKMESVEEFEGLDSPEFENVFVVTDFQDSVFNDLYKADCRVIGPPVVLNCSQKGEPLPFSCRPLYCTSMMNLVLCFTGFRKKEELVRLVTLVHHMGGVIRKDFNSKVTHLVANCTQGEKFRVAVSLGTPIMKPEWIYKAWERRNEQDFYAAVDDFRNEFKVPPFQDCILSFLGFSDEEKTNMEEMTEMQGGKYLPLGDERCTHLVVEENIVKDLPFEPSKKLYVVKQEWFWGSIQMDARAGETMYLYEKANTPELKKSVSMLSLNTPNSNRKRR
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol ECT2
Synonyms ECT2; epithelial cell transforming sequence 2 oncogene; protein ECT2; ARHGEF31; epithelial cell-transforming sequence 2 oncogene; FLJ10461; MGC138291;
Gene ID 1894
mRNA Refseq NM_001258315
Protein Refseq NP_001245244
MIM 600586
UniProt ID Q9H8V3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ECT2 Products

Required fields are marked with *

My Review for All ECT2 Products

Required fields are marked with *

0
cart-icon