Recombinant Human EEF1A2 protein, His-tagged
Cat.No. : | EEF1A2-12290H |
Product Overview : | Recombinant Human EEF1A2 protein(NP_001949.1)(Gly213~Lys463), fused to His-tag at N-terminus, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Gly213~Lys463 |
Description : | This gene encodes an isoform of the alpha subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This isoform (alpha 2) is expressed in brain, heart and skeletal muscle, and the other isoform (alpha 1) is expressed in brain, placenta, lung, liver, kidney, and pancreas. This gene may be critical in the development of ovarian cancer. |
Form : | Supplied as lyophilized form in 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% sarcosyl, 5% trehalose, and preservative. |
Molecular Mass : | 36kDa as determined by SDS-PAGE reducing conditions. |
AA Sequence : | GWKVERKEGNASGVSLLEALDTILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGILRPGMVVTFAPVNITTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDIRRGNVCGDSKSDPPQEAAQFTSQVIILNHPGQISAGYSPVIDCHTAHIACKFAELKEKIDRRSGKKLEDNPKSLKSGDAAIVEMVPGKPMCVESFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKSGGAGKVTKSAQKAQKAGK |
Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
Purity : | > 90% |
Applications : | Positive Control; Immunogen; SDS-PAGE; WB. If bio-activity of the protein is needed, please check active protein. |
Notes : | The possible reasons that the actual band size differs from the predicted are as follows: 1. Splice variants: Alternative splicing may create different sized proteins from the same gene. 2. Relative charge: The composition of amino acids may affects the charge of the protein. 3. Post-translational modification: Phosphorylation, glycosylation, methylation etc. 4. Post-translation cleavage: Many proteins are synthesized as pro-proteins, and then cleaved to give the active form. 5. Polymerization of the target protein: Dimerization, multimerization etc. |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months. |
Reconstitution : | Reconstitute in sterile ddH2O. |
Gene Name | EEF1A2 eukaryotic translation elongation factor 1 alpha 2 [ Homo sapiens (human) ] |
Official Symbol | EEF1A2 |
Synonyms | STN; EF1A; EEF1AL; EF-1-alpha-2; HS1; STNL; Statin-Like; Statin-S1; Eukaryotic elongation factor 1 A-2 |
Gene ID | 1917 |
mRNA Refseq | NM_001958.5 |
Protein Refseq | NP_001949.1 |
MIM | 602959 |
UniProt ID | Q05639 |
◆ Recombinant Proteins | ||
EEF1A2-2646M | Recombinant Mouse EEF1A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EEF1A2-2014R | Recombinant Rat EEF1A2 Protein | +Inquiry |
EEF1A2-1671R | Recombinant Rat EEF1A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EEF1A2-12290H | Recombinant Human EEF1A2 protein, His-tagged | +Inquiry |
EEF1A2-3067H | Recombinant Human EEF1A2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EEF1A2-242HCL | Recombinant Human EEF1A2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEF1A2 Products
Required fields are marked with *
My Review for All EEF1A2 Products
Required fields are marked with *