Recombinant Human EFEMP2 protein(31-120 aa), C-His-tagged

• Cat.No.: EFEMP2-2494H
• Product Overview: Recombinant Human EFEMP2 protein(O95967)(31-120 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 31-120 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: EEPDSYTECTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDS

Gene Information

• Gene Name: EFEMP2 EGF containing fibulin-like extracellular matrix protein 2 [ Homo sapiens ]
• Official Symbol: EFEMP2
• Synonyms: EFEMP2; EGF containing fibulin-like extracellular matrix protein 2; EGF containing fibulin like extracellular matrix protein 2; EGF-containing fibulin-like extracellular matrix protein 2; FBLN4; fibulin 4; UPH1; FIBL-4; fibulin-4; mutant p53 binding protein 1; MBP1; ARCL1B
• Gene ID: 30008
• mRNA Refseq: NM_016938
• Protein Refseq: NP_058634
• MIM: 604633
• UniProt ID: O95967