Recombinant Human EFEMP2 protein(31-120 aa), C-His-tagged
Cat.No. : | EFEMP2-2494H |
Product Overview : | Recombinant Human EFEMP2 protein(O95967)(31-120 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-120 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | EEPDSYTECTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDS |
Gene Name | EFEMP2 EGF containing fibulin-like extracellular matrix protein 2 [ Homo sapiens ] |
Official Symbol | EFEMP2 |
Synonyms | EFEMP2; EGF containing fibulin-like extracellular matrix protein 2; EGF containing fibulin like extracellular matrix protein 2; EGF-containing fibulin-like extracellular matrix protein 2; FBLN4; fibulin 4; UPH1; FIBL-4; fibulin-4; mutant p53 binding protein 1; MBP1; ARCL1B; |
Gene ID | 30008 |
mRNA Refseq | NM_016938 |
Protein Refseq | NP_058634 |
MIM | 604633 |
UniProt ID | O95967 |
◆ Recombinant Proteins | ||
Efemp2-233M | Recombinant Mouse Efemp2 Protein, His-tagged | +Inquiry |
EFEMP2-3086H | Recombinant Human EFEMP2 Protein, GST-tagged | +Inquiry |
EFEMP2-4184HF | Recombinant Full Length Human EFEMP2 Protein, GST-tagged | +Inquiry |
EFEMP2-2107H | Recombinant Human EFEMP2 Protein (Ser26-Phe443), N-GST tagged | +Inquiry |
EFEMP2-229H | Recombinant Human EFEMP2 Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFEMP2-6704HCL | Recombinant Human EFEMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFEMP2 Products
Required fields are marked with *
My Review for All EFEMP2 Products
Required fields are marked with *
0
Inquiry Basket