Recombinant Human EFEMP2 protein(31-120 aa), C-His-tagged

Cat.No. : EFEMP2-2494H
Product Overview : Recombinant Human EFEMP2 protein(O95967)(31-120 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 31-120 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : EEPDSYTECTDGYEWDPDSQHCRDVNECLTIPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAQHPNPCPPGYEPDDQDS
Gene Name EFEMP2 EGF containing fibulin-like extracellular matrix protein 2 [ Homo sapiens ]
Official Symbol EFEMP2
Synonyms EFEMP2; EGF containing fibulin-like extracellular matrix protein 2; EGF containing fibulin like extracellular matrix protein 2; EGF-containing fibulin-like extracellular matrix protein 2; FBLN4; fibulin 4; UPH1; FIBL-4; fibulin-4; mutant p53 binding protein 1; MBP1; ARCL1B;
Gene ID 30008
mRNA Refseq NM_016938
Protein Refseq NP_058634
MIM 604633
UniProt ID O95967

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFEMP2 Products

Required fields are marked with *

My Review for All EFEMP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon