Recombinant Human EFNA2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EFNA2-3054H |
Product Overview : | EFNA2 MS Standard C13 and N15-labeled recombinant protein (NP_001396) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm. |
Molecular Mass : | 23.88 kDa |
AA Sequence : | MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EFNA2 ephrin-A2 [ Homo sapiens (human) ] |
Official Symbol | EFNA2 |
Synonyms | EFNA2; ephrin-A2; EPLG6; ELF 1; LERK6; HEK7 ligand; eph-related receptor tyrosine kinase ligand 6; ELF-1; HEK7-L; LERK-6; |
Gene ID | 1943 |
mRNA Refseq | NM_001405 |
Protein Refseq | NP_001396 |
MIM | 602756 |
UniProt ID | O43921 |
◆ Recombinant Proteins | ||
Efna2-4047M | Active Recombinant Mouse Efna2 protein, His-tagged | +Inquiry |
EFNA2-3054H | Recombinant Human EFNA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EFNA2-978H | Active Recombinant Human EFNA2 Protein, Fc Chimera | +Inquiry |
Efna2-1731M | Recombinant Mouse Ephrin A2 | +Inquiry |
EFNA2-3098H | Recombinant Human EFNA2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNA2-2004MCL | Recombinant Mouse EFNA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EFNA2 Products
Required fields are marked with *
My Review for All EFNA2 Products
Required fields are marked with *
0
Inquiry Basket