Recombinant Human EFNA2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : EFNA2-3054H
Product Overview : EFNA2 MS Standard C13 and N15-labeled recombinant protein (NP_001396) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm.
Molecular Mass : 23.88 kDa
AA Sequence : MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name EFNA2 ephrin-A2 [ Homo sapiens (human) ]
Official Symbol EFNA2
Synonyms EFNA2; ephrin-A2; EPLG6; ELF 1; LERK6; HEK7 ligand; eph-related receptor tyrosine kinase ligand 6; ELF-1; HEK7-L; LERK-6;
Gene ID 1943
mRNA Refseq NM_001405
Protein Refseq NP_001396
MIM 602756
UniProt ID O43921

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFNA2 Products

Required fields are marked with *

My Review for All EFNA2 Products

Required fields are marked with *

0
cart-icon