Recombinant Human EFNA3 Protein, Fc-tagged
Cat.No. : | EFNA3-231H |
Product Overview : | Recombinant human EFNA3 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 238 |
Description : | This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. |
Form : | Lyophilized |
Molecular Mass : | 48 kDa |
AA Sequence : | MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | EFNA3 ephrin-A3 [ Homo sapiens (human) ] |
Official Symbol | EFNA3 |
Synonyms | EFNA3; ephrin-A3; EPLG3; Ehk1 L; LERK3; EFL-2; LERK-3; EHK1 ligand; ligand of eph-related kinase 3; eph-related receptor tyrosine kinase ligand 3; EFL2; Ehk1-L; |
Gene ID | 1944 |
mRNA Refseq | NM_004952 |
Protein Refseq | NP_004943 |
MIM | 601381 |
UniProt ID | P52797 |
◆ Recombinant Proteins | ||
Efna3-630M | Active Recombinant Mouse Efna3 Protein, Fc Chimera | +Inquiry |
EFNA3-699H | Active Recombinant Human EFNA3 protein(Met 1-Ser 213) | +Inquiry |
EFNA3-140HF | Recombinant Full Length Human EFNA3 Protein | +Inquiry |
EFNA3-155H | Active Recombinant Human EFNA3 protein, His-tagged | +Inquiry |
EFNA3-231H | Recombinant Human EFNA3 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNA3-2160MCL | Recombinant Mouse EFNA3 cell lysate | +Inquiry |
EFNA3-2437HCL | Recombinant Human EFNA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EFNA3 Products
Required fields are marked with *
My Review for All EFNA3 Products
Required fields are marked with *
0
Inquiry Basket