Recombinant Human EFNA4 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : EFNA4-3461H
Product Overview : EFNA4 MS Standard C13 and N15-labeled recombinant protein (NP_872632) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. Three transcript variants that encode distinct proteins have been identified.
Molecular Mass : 21.7 kDa
AA Sequence : MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERNLPSHPKEPESSQDPLEEEGSLLPALGVPIQTDKMEHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name EFNA4 ephrin-A4 [ Homo sapiens (human) ]
Official Symbol EFNA4
Synonyms EFNA4; ephrin-A4; EPLG4; LERK4; LERK-4; ligand of eph-related kinase 4; eph-related receptor tyrosine kinase ligand 4; EFL4; FLJ57652; MGC125826;
Gene ID 1945
mRNA Refseq NM_182690
Protein Refseq NP_872632
MIM 601380
UniProt ID P52798

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFNA4 Products

Required fields are marked with *

My Review for All EFNA4 Products

Required fields are marked with *

0
cart-icon