Recombinant Human EFNA4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EFNA4-3461H |
Product Overview : | EFNA4 MS Standard C13 and N15-labeled recombinant protein (NP_872632) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. Three transcript variants that encode distinct proteins have been identified. |
Molecular Mass : | 21.7 kDa |
AA Sequence : | MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERNLPSHPKEPESSQDPLEEEGSLLPALGVPIQTDKMEHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EFNA4 ephrin-A4 [ Homo sapiens (human) ] |
Official Symbol | EFNA4 |
Synonyms | EFNA4; ephrin-A4; EPLG4; LERK4; LERK-4; ligand of eph-related kinase 4; eph-related receptor tyrosine kinase ligand 4; EFL4; FLJ57652; MGC125826; |
Gene ID | 1945 |
mRNA Refseq | NM_182690 |
Protein Refseq | NP_872632 |
MIM | 601380 |
UniProt ID | P52798 |
◆ Recombinant Proteins | ||
Efna4-10538M | Recombinant Mouse Efna4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Efna4-4056M | Recombinant Mouse Efna4 protein(Met1-Gly176), hFc-tagged | +Inquiry |
EFNA4-177H | Recombinant Human EFNA4 protein, hFc-tagged | +Inquiry |
EFNA4-4336H | Recombinant Human Ephrin-A4, GST-Tagged | +Inquiry |
Efna4-4057M | Active Recombinant Mouse Efna4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNA4-001HCL | Recombinant Human EFNA4 cell lysate | +Inquiry |
EFNA4-2158MCL | Recombinant Mouse EFNA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EFNA4 Products
Required fields are marked with *
My Review for All EFNA4 Products
Required fields are marked with *
0
Inquiry Basket