Recombinant Human EFNA5 Protein, 21-203aa, C-hIgG-His tagged

Cat.No. : EFNA5-038H
Product Overview : Recombinant human Ephrin-A5, 21-203aa, fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect cells
Tag : Fc&His
Protein Length : 21-203aa
Description : Ephrin-A5, as known as EFNA5, is a member of the ephrin ligand family which binds the members of ephrin receptor subfamily of tyrosine kinases. This protein is expressed with the highest levels in human adult brain, heart, spleen, and ovary and human fetal brain, lung, and kidney. It is also expressed by muscle precursor cells and interacts with ephrin-A4 to restrict their migration to the correct locations during forelimb morphogenesis.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Mouse EphA3. The ED50 range ≤ 60 ng/mL.
Molecular Mass : 48.1 kDa (422aa)
AA Sequence : QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
References : 1. Son AI., et al. (2013) Mol. Vis. 19:254-266.
2. Wang TH., et al. (2012) FEBS J. 279:251-263.
Gene Name EFNA5 ephrin-A5 [ Homo sapiens (human) ]
Official Symbol EFNA5
Synonyms EFNA5; ephrin-A5; EPLG7; AF1; LERK7; AL-1; LERK-7; eph-related receptor tyrosine kinase ligand 7; EFL5; RAGS; GLC1M
Gene ID 1946
mRNA Refseq NM_001962
Protein Refseq NP_001953
MIM 601535
UniProt ID P52803

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFNA5 Products

Required fields are marked with *

My Review for All EFNA5 Products

Required fields are marked with *

0
cart-icon