Recombinant Human EFNA5 Protein, GST-tagged
| Cat.No. : | EFNA5-3101H |
| Product Overview : | Human EFNA5 partial ORF ( NP_001953, 114 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Ephrin-A5, a member of the ephrin gene family, prevents axon bundling in cocultures of cortical neurons with astrocytes, a model of late stage nervous system development and differentiation. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. EPH receptors typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin ligands and receptors have been named by the Eph Nomenclature Committee (1997). Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are similarly divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 35.64 kDa |
| AA Sequence : | FSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EFNA5 ephrin-A5 [ Homo sapiens ] |
| Official Symbol | EFNA5 |
| Synonyms | EFNA5; ephrin-A5; EPLG7; AF1; LERK7; AL-1; LERK-7; eph-related receptor tyrosine kinase ligand 7; EFL5; RAGS; GLC1M; |
| Gene ID | 1946 |
| mRNA Refseq | NM_001962 |
| Protein Refseq | NP_001953 |
| MIM | 601535 |
| UniProt ID | P52803 |
| ◆ Recombinant Proteins | ||
| EFNA5-4397H | Recombinant Human EFNA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EFNA5-993C | Active Recombinant Canine EFNA5 protein, Fc-tagged | +Inquiry |
| Efna5-4059M | Active Recombinant Mouse Efna5 protein, hFc-tagged | +Inquiry |
| EFNA5-1133H | Recombinant Human EFNA5 protein, His & T7-tagged | +Inquiry |
| EFNA5-3006H | Recombinant Human EFNA5 Protein (Gln21-Asn203), C-Fc tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EFNA5-2734HCL | Recombinant Human EFNA5 cell lysate | +Inquiry |
| EFNA5-2156MCL | Recombinant Mouse EFNA5 cell lysate | +Inquiry |
| EFNA5-1574RCL | Recombinant Rat EFNA5 cell lysate | +Inquiry |
| EFNA5-1430CCL | Recombinant Cynomolgus EFNA5 cell lysate | +Inquiry |
| EFNA5-993CCL | Recombinant Canine EFNA5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFNA5 Products
Required fields are marked with *
My Review for All EFNA5 Products
Required fields are marked with *
