Recombinant Human EFNB1 protein, His-tagged
| Cat.No. : | EFNB1-2973H |
| Product Overview : | Recombinant Human EFNB1 protein(167 - 243 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 16, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 167 - 243 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | DPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVALFAA |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | EFNB1 ephrin-B1 [ Homo sapiens ] |
| Official Symbol | EFNB1 |
| Synonyms | EFNB1; ephrin-B1; CFNS, craniofrontonasal syndrome (craniofrontonasal dysplasia) , EPLG2; Elk L; LERK2; EFL-3; LERK-2; ELK ligand; ligand of eph-related kinase 2; eph-related receptor tyrosine kinase ligand 2; CFND; CFNS; EFL3; EPLG2; Elk-L; MGC8782; |
| Gene ID | 1947 |
| mRNA Refseq | NM_004429 |
| Protein Refseq | NP_004420 |
| MIM | 300035 |
| UniProt ID | P98172 |
| ◆ Recombinant Proteins | ||
| EFNB1-1259H | Recombinant Human EFNB1 protein, hFc&His-tagged | +Inquiry |
| RFL35122GF | Recombinant Full Length Chicken Ephrin-B1(Efnb1) Protein, His-Tagged | +Inquiry |
| Efnb1-4049M | Active Recombinant Mouse Efnb1 protein, hFc-tagged | +Inquiry |
| EFNB1-451H | Recombinant Human EFNB1 Protein, His-tagged | +Inquiry |
| Efnb1-4050M | Recombinant Mouse Efnb1 protein(Met1-Ser229), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EFNB1-2152MCL | Recombinant Mouse EFNB1 cell lysate | +Inquiry |
| EFNB1-1515RCL | Recombinant Rat EFNB1 cell lysate | +Inquiry |
| EFNB1-2537HCL | Recombinant Human EFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFNB1 Products
Required fields are marked with *
My Review for All EFNB1 Products
Required fields are marked with *
