"EFNB1" Related Products

Expand
Expand
Expand

Recombinant Human EFNB1 Protein, hIgG-His-tagged

Cat.No. : EFNB1-001H
Product Overview : Recombinant human EFNB1 protein(28-237aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description : EFNB1, also known as ephrin-B1, is a member of Eph family. It binds to the receptor tyrosine kinases EPHB1 and EPHA1. This protein also binds Eph receptors residing on adjacent cells which affect signaling to neighboring cells. It plays a role in cellular migration, axon guidance, osteoclast differentiation and function, cardiac muscle morphogenesis, and tumorigenesis.
Source : Insect cell
Species : Human
Tag : hIgG-His
Form : Liquid
Molecular Mass : 50.3 kDa
AASequence : ADPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
N-terminal Sequence Analysis : Ala
Endotoxin : < 0.1 EU per 1μg of protein (determined by LAL method)
Purity : > 90% by SDS - PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1.0 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Warning : For research use only. This product is not intended or approved for human, diagnostics or veterin
SDS-PAGE :

15% SDS-PAGE (3 μg)

Gene Name : EFNB1 ephrin B1 [ Homo sapiens (human) ]
Official Symbol : EFNB1
Synonyms : EFNB1; ephrin B1; CFND; CFNS; EFB1; EFL3; EPLG2; Elk-L; LERK2;
Gene ID : 1947
mRNA Refseq : NM_004429
Protein Refseq : NP_004420
MIM : 300035
UniProt ID : P98172

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.