Recombinant Human EFNB1 Protein, hIgG-His-tagged

Cat.No. : EFNB1-001H
Product Overview : Recombinant human EFNB1 protein(28-237aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Availability June 27, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : Fc&His
Protein Length : 28-237 a.a.
Description : EFNB1, also known as ephrin-B1, is a member of Eph family. It binds to the receptor tyrosine kinases EPHB1 and EPHA1. This protein also binds Eph receptors residing on adjacent cells which affect signaling to neighboring cells. It plays a role in cellular migration, axon guidance, osteoclast differentiation and function, cardiac muscle morphogenesis, and tumorigenesis.
Form : Liquid
Molecular Mass : 50.3 kDa
N-terminal Sequence Analysis : Ala
Endotoxin : < 0.1 EU per 1μg of protein (determined by LAL method)
Purity : > 90% by SDS - PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1.0 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Warning : For research use only. This product is not intended or approved for human, diagnostics or veterin
AA Sequence : ADPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Gene Name EFNB1 ephrin B1 [ Homo sapiens (human) ]
Official Symbol EFNB1
Synonyms EFNB1; ephrin B1; CFND; CFNS; EFB1; EFL3; EPLG2; Elk-L; LERK2;
Gene ID 1947
mRNA Refseq NM_004429
Protein Refseq NP_004420
MIM 300035
UniProt ID P98172

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFNB1 Products

Required fields are marked with *

My Review for All EFNB1 Products

Required fields are marked with *

0
cart-icon