Recombinant Human EFNB1 Protein, His-tagged
Cat.No. : | EFNB1-451H |
Product Overview : | Recombinant Human EFNB1 Protien(NP_004420)(32-239 aa), fused to His tag, was expressed in E. coli. |
Availability | June 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 32-239 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | LEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | EFNB1 ephrin-B1 [ Homo sapiens ] |
Official Symbol | EFNB1 |
Synonyms | EFNB1; ephrin-B1; CFNS, craniofrontonasal syndrome (craniofrontonasal dysplasia) , EPLG2; Elk L; LERK2; EFL-3; LERK-2; ELK ligand; ligand of eph-related kinase 2; eph-related receptor tyrosine kinase ligand 2; CFND; CFNS; EFL3; EPLG2; Elk-L; MGC8782; |
Gene ID | 1947 |
mRNA Refseq | NM_004429 |
Protein Refseq | NP_004420 |
MIM | 300035 |
UniProt ID | P98172 |
◆ Recombinant Proteins | ||
EFNB1-1383H | Recombinant Human EFNB1 Protein, MYC/DDK-tagged | +Inquiry |
EFNB1-2239H | Recombinant Human EFNB1, Fc-His tagged | +Inquiry |
EFNB1-1259H | Recombinant Human EFNB1 protein, hFc&His-tagged | +Inquiry |
EFNB1-001H | Recombinant Human EFNB1 Protein, hIgG-His-tagged | +Inquiry |
EFNB1-301454H | Recombinant Human EFNB1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNB1-2152MCL | Recombinant Mouse EFNB1 cell lysate | +Inquiry |
EFNB1-1515RCL | Recombinant Rat EFNB1 cell lysate | +Inquiry |
EFNB1-2537HCL | Recombinant Human EFNB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFNB1 Products
Required fields are marked with *
My Review for All EFNB1 Products
Required fields are marked with *