Recombinant Human EGF protein, GST-tagged
Cat.No. : | EGF-12320H |
Product Overview : | Recombinant Human EGF protein(971-1023 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | October 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 971-1023 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
Gene Name | EGF epidermal growth factor [ Homo sapiens ] |
Official Symbol | EGF |
Synonyms | EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4; |
Gene ID | 1950 |
mRNA Refseq | NM_001178130 |
Protein Refseq | NP_001171601 |
MIM | 131530 |
UniProt ID | P01133 |
◆ Recombinant Proteins | ||
EGF-166H | Recombinant Human Epidermal Growth Factor 21-Leu | +Inquiry |
EGF-2039H | Recombinant Human EGF Protein (Asn971-Arg1023) | +Inquiry |
EGF-2809D | Recombinant Dog EGF protein, His-tagged | +Inquiry |
EGF-73H | Active Recombinant Human EGF Protein (Asn971-Arg1023), C-His tagged, Animal-free, Carrier-free | +Inquiry |
EGF-7474H | Recombinant Human EGF protein | +Inquiry |
◆ Native Proteins | ||
Egf-635R | Native Rat Egf | +Inquiry |
Egf -635R | Native Rat Egf protein | +Inquiry |
EGF-26462TH | Native Human EGF | +Inquiry |
EGF-23H | Active Native Human EGF protein | +Inquiry |
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGF Products
Required fields are marked with *
My Review for All EGF Products
Required fields are marked with *