Recombinant Human EIF4EBP3 Protein, GST-tagged
| Cat.No. : | EIF4EBP3-3206H |
| Product Overview : | Human EIF4EBP3 full-length ORF ( AAH10881, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the EIF4EBP family, which consists of proteins that bind to eukaryotic translation initiation factor 4E and regulate its assembly into EIF4F, the multi-subunit translation initiation factor that recognizes the mRNA cap structure. Read-through transcription from the neighboring upstream gene (MASK or ANKHD1) generates a transcript (MASK-BP3) that encodes a protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. [provided by RefSeq, Oct 2010] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EIF4EBP3 eukaryotic translation initiation factor 4E binding protein 3 [ Homo sapiens ] |
| Official Symbol | EIF4EBP3 |
| Synonyms | EIF4EBP3; eukaryotic translation initiation factor 4E binding protein 3; eukaryotic translation initiation factor 4E-binding protein 3; 4E BP3; eIF4E-binding protein 3; eukaryotic initiation factor 4E-binding protein 3; 4EBP3; 4E-BP3; |
| Gene ID | 8637 |
| mRNA Refseq | NM_003732 |
| Protein Refseq | NP_003723 |
| MIM | 603483 |
| UniProt ID | O60516 |
| ◆ Recombinant Proteins | ||
| EIF4EBP3-4296HF | Recombinant Full Length Human EIF4EBP3 Protein, GST-tagged | +Inquiry |
| EIF4EBP3-3889H | Recombinant Human EIF4EBP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| EIF4EBP3-1743Z | Recombinant Zebrafish EIF4EBP3 | +Inquiry |
| EIF4EBP3-3206H | Recombinant Human EIF4EBP3 Protein, GST-tagged | +Inquiry |
| Eif4ebp3-362M | Recombinant Mouse Eif4ebp3 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF4EBP3-6647HCL | Recombinant Human EIF4EBP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4EBP3 Products
Required fields are marked with *
My Review for All EIF4EBP3 Products
Required fields are marked with *
