Recombinant Human EIF4EBP3 Protein, GST-tagged

• Cat.No.: EIF4EBP3-3206H
• Product Overview: Human EIF4EBP3 full-length ORF ( AAH10881, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the EIF4EBP family, which consists of proteins that bind to eukaryotic translation initiation factor 4E and regulate its assembly into EIF4F, the multi-subunit translation initiation factor that recognizes the mRNA cap structure. Read-through transcription from the neighboring upstream gene (MASK or ANKHD1) generates a transcript (MASK-BP3) that encodes a protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. [provided by RefSeq, Oct 2010]
• Molecular Mass: 36.74 kDa
• AA Sequence: MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF4EBP3 eukaryotic translation initiation factor 4E binding protein 3 [ Homo sapiens ]
• Official Symbol: EIF4EBP3
• Synonyms: EIF4EBP3; eukaryotic translation initiation factor 4E binding protein 3; eukaryotic translation initiation factor 4E-binding protein 3; 4E BP3; eIF4E-binding protein 3; eukaryotic initiation factor 4E-binding protein 3; 4EBP3; 4E-BP3
• Gene ID: 8637
• mRNA Refseq: NM_003732
• Protein Refseq: NP_003723
• MIM: 603483
• UniProt ID: O60516