Recombinant Human EIF4G1 protein, Myc/DDK-tagged
Cat.No. : | EIF4G1-02H |
Product Overview : | Recombinant Human EIF4G1 protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Pathways: Viral myocarditis. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a component of the multi-subunit protein complex EIF4F. This complex facilitates the recruitment of mRNA to the ribosome, which is a rate-limiting step during the initiation phase of protein synthesis. The recognition of the mRNA cap and the ATP-dependent unwinding of 5'-terminal secondary structure is catalyzed by factors in this complex. The subunit encoded by this gene is a large scaffolding protein that contains binding sites for other members of the EIF4F complex. A domain at its N-terminus can also interact with the poly(A)-binding protein, which may mediate the circularization of mRNA during translation. Alternative splicing results in multiple transcript variants, some of which are derived from alternative promoter usage. |
Form : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 175.3 kDa |
AA Sequence : | myc-FLAG tag |
Product-Related Proteins : | TA50011-100 LC404962 TA351152 RC219841 |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Usage : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL |
Gene Name | EIF4G1 eukaryotic translation initiation factor 4 gamma 1 [ Homo sapiens (human) ] |
Official Symbol | EIF4G1 |
Synonyms | EIF-4G1; EIF4F; EIF4G; EIF4GI; P220; PARK18 |
Gene ID | 1981 |
mRNA Refseq | NM_198241 |
Protein Refseq | NP_937884 |
MIM | 600495 |
UniProt ID | Q96I65 |
◆ Recombinant Proteins | ||
EIF4G1-12384H | Recombinant Human EIF4G1 protein, GST-tagged | +Inquiry |
EIF4G1-2844H | Recombinant Human EIF4G1 protein, His-B2M-JD & Myc-tagged | +Inquiry |
EIF4G1-1009HFL | Recombinant Full Length Human EIF4G1 Protein, C-Flag-tagged | +Inquiry |
EIF4G1-830H | Recombinant Human EIF4G1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF4G1-01H | Active Recombinant Human EIF4G1 protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4G1-545HCL | Recombinant Human EIF4G1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4G1 Products
Required fields are marked with *
My Review for All EIF4G1 Products
Required fields are marked with *
0
Inquiry Basket