Recombinant Human EIF4G2 Protein, GST-tagged

Cat.No. : EIF4G2-3211H
Product Overview : Human EIF4G2 partial ORF ( NP_001409, 811 a.a. - 889 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jul 2008]
Molecular Mass : 34.43 kDa
AA Sequence : SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EIF4G2 eukaryotic translation initiation factor 4 gamma, 2 [ Homo sapiens ]
Official Symbol EIF4G2
Synonyms EIF4G2; eukaryotic translation initiation factor 4 gamma, 2; eukaryotic translation initiation factor 4 gamma 2; DAP5; NAT1; p97; DAP-5; eIF4G 2; eIF-4G 2; eIF-4-gamma 2; aging-associated protein 1; death-associated protein 5; eukaryotic translation initiation factor 4G-like 1; P97; AAG1; FLJ41344;
Gene ID 1982
mRNA Refseq NM_001042559
Protein Refseq NP_001036024
MIM 602325
UniProt ID P78344

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4G2 Products

Required fields are marked with *

My Review for All EIF4G2 Products

Required fields are marked with *

0
cart-icon
0
compare icon