Recombinant Human EIF4G2 Protein, GST-tagged
Cat.No. : | EIF4G2-3211H |
Product Overview : | Human EIF4G2 partial ORF ( NP_001409, 811 a.a. - 889 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 34.43 kDa |
AA Sequence : | SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF4G2 eukaryotic translation initiation factor 4 gamma, 2 [ Homo sapiens ] |
Official Symbol | EIF4G2 |
Synonyms | EIF4G2; eukaryotic translation initiation factor 4 gamma, 2; eukaryotic translation initiation factor 4 gamma 2; DAP5; NAT1; p97; DAP-5; eIF4G 2; eIF-4G 2; eIF-4-gamma 2; aging-associated protein 1; death-associated protein 5; eukaryotic translation initiation factor 4G-like 1; P97; AAG1; FLJ41344; |
Gene ID | 1982 |
mRNA Refseq | NM_001042559 |
Protein Refseq | NP_001036024 |
MIM | 602325 |
UniProt ID | P78344 |
◆ Recombinant Proteins | ||
EIF4G2-3683H | Recombinant Human EIF4G2 protein, His-tagged | +Inquiry |
EIF4G2-3423C | Recombinant Chicken EIF4G2 | +Inquiry |
EIF4G2-3725C | Recombinant Chicken EIF4G2 | +Inquiry |
EIF4G2-5115M | Recombinant Mouse EIF4G2 Protein | +Inquiry |
EIF4G2-2725M | Recombinant Mouse EIF4G2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4G2-6646HCL | Recombinant Human EIF4G2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4G2 Products
Required fields are marked with *
My Review for All EIF4G2 Products
Required fields are marked with *