Recombinant Human EIF4G2 protein, His-tagged

Cat.No. : EIF4G2-3683H
Product Overview : Recombinant Human EIF4G2 protein(563-907 aa), fused to His tag, was expressed in E. coli.
Availability August 02, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 563-907 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : EAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKASSLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYLAQFAARAIISELVSISELAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETAEEEESEEEAD
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name EIF4G2 eukaryotic translation initiation factor 4 gamma, 2 [ Homo sapiens ]
Official Symbol EIF4G2
Synonyms EIF4G2; eukaryotic translation initiation factor 4 gamma, 2; eukaryotic translation initiation factor 4 gamma 2; DAP5; NAT1; p97; DAP-5; eIF4G 2; eIF-4G 2; eIF-4-gamma 2; aging-associated protein 1; death-associated protein 5; eukaryotic translation initiation factor 4G-like 1; P97; AAG1; FLJ41344;
Gene ID 1982
mRNA Refseq NM_001042559
Protein Refseq NP_001036024
MIM 602325
UniProt ID P78344

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4G2 Products

Required fields are marked with *

My Review for All EIF4G2 Products

Required fields are marked with *

0
cart-icon