Recombinant Human EIF4G2 protein, His-tagged
Cat.No. : | EIF4G2-3683H |
Product Overview : | Recombinant Human EIF4G2 protein(563-907 aa), fused to His tag, was expressed in E. coli. |
Availability | August 22, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 563-907 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | EAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKASSLISLLKQEGIATSDNFMQAFLNVLDQCPKLEVDIPLVKSYLAQFAARAIISELVSISELAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVNMQKMLPEIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETAEEEESEEEAD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | EIF4G2 eukaryotic translation initiation factor 4 gamma, 2 [ Homo sapiens ] |
Official Symbol | EIF4G2 |
Synonyms | EIF4G2; eukaryotic translation initiation factor 4 gamma, 2; eukaryotic translation initiation factor 4 gamma 2; DAP5; NAT1; p97; DAP-5; eIF4G 2; eIF-4G 2; eIF-4-gamma 2; aging-associated protein 1; death-associated protein 5; eukaryotic translation initiation factor 4G-like 1; P97; AAG1; FLJ41344; |
Gene ID | 1982 |
mRNA Refseq | NM_001042559 |
Protein Refseq | NP_001036024 |
MIM | 602325 |
UniProt ID | P78344 |
◆ Recombinant Proteins | ||
EIF4G2-3211H | Recombinant Human EIF4G2 Protein, GST-tagged | +Inquiry |
EIF4G2-3423C | Recombinant Chicken EIF4G2 | +Inquiry |
EIF4G2-3725C | Recombinant Chicken EIF4G2 | +Inquiry |
EIF4G2-5115M | Recombinant Mouse EIF4G2 Protein | +Inquiry |
EIF4G2-3683H | Recombinant Human EIF4G2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4G2-6646HCL | Recombinant Human EIF4G2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4G2 Products
Required fields are marked with *
My Review for All EIF4G2 Products
Required fields are marked with *