Recombinant Human EMC8 Protein, GST-tagged
Cat.No. : | EMC8-1747H |
Product Overview : | Human COX4NB full-length ORF ( AAH05886, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | EMC8 (ER Membrane Protein Complex Subunit 8) is a Protein Coding gene. An important paralog of this gene is EMC9. |
Molecular Mass : | 48.73 kDa |
AA Sequence : | MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EMC8 ER membrane protein complex subunit 8 [ Homo sapiens (human) ] |
Official Symbol | EMC8 |
Synonyms | EMC8; ER membrane protein complex subunit 8; COX4NB; COX4 neighbor; C16orf2, C16orf4, chromosome 16 open reading frame 2 , chromosome 16 open reading frame 4 , neighbor of COX4 , NOC4; neighbor of COX4; FAM158B; family with sequence similarity 158; member B; family with sequence similarity 158, member B; NOC4; C16orf2; C16orf4; |
Gene ID | 10328 |
mRNA Refseq | NM_001142288 |
Protein Refseq | NP_001135760 |
MIM | 604886 |
UniProt ID | O43402 |
◆ Recombinant Proteins | ||
EMC8-12549Z | Recombinant Zebrafish EMC8 | +Inquiry |
EMC8-2005HF | Recombinant Full Length Human EMC8 Protein, GST-tagged | +Inquiry |
EMC8-1747H | Recombinant Human EMC8 Protein, GST-tagged | +Inquiry |
EMC8-2844H | Recombinant Human EMC8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EMC8-5167M | Recombinant Mouse EMC8 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMC8 Products
Required fields are marked with *
My Review for All EMC8 Products
Required fields are marked with *