Recombinant Human ENAM protein, His-tagged
| Cat.No. : | ENAM-4580H | 
| Product Overview : | Recombinant Human ENAM protein(Q9NRM1)(1043-1142 aa), fused with C-terminal His tag, was expressed in E.coli. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1043-1142 aa | 
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. | 
| Molecular Mass : | 18.0 kDa | 
| AASequence : | ERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQA | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. | 
| Gene Name | ENAM enamelin [ Homo sapiens ] | 
| Official Symbol | ENAM | 
| Synonyms | ENAM; enamelin; AIH2, amelogenesis imperfecta 2, hypocalcification (autosomal dominant); amelogenesis imperfecta 2, hypocalcification (autosomal dominant); ADAI; AI1C; AIH2; | 
| Gene ID | 10117 | 
| mRNA Refseq | NM_031889 | 
| Protein Refseq | NP_114095 | 
| MIM | 606585 | 
| UniProt ID | Q9NRM1 | 
| ◆ Recombinant Proteins | ||
| ENAM-43H | Recombinant Human ENAM protein, GST-tagged | +Inquiry | 
| ENAM-4580H | Recombinant Human ENAM protein, His-tagged | +Inquiry | 
| ENAM-5194M | Recombinant Mouse ENAM Protein | +Inquiry | 
| ENAM-4703H | Recombinant Human ENAM protein, His-tagged | +Inquiry | 
| ENAM-2786M | Recombinant Mouse ENAM Protein, His (Fc)-Avi-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All ENAM Products
Required fields are marked with *
My Review for All ENAM Products
Required fields are marked with *
  
        
    
      
            