Recombinant Human ENAM protein, His-tagged

• Cat.No.: ENAM-4703H
• Product Overview: Recombinant Human ENAM protein(Q9NRM1)(1043-1142 aa), fused with C-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1043-1142 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 12.6 kDa
• AASequence: ERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQA
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: ENAM enamelin [ Homo sapiens ]
• Official Symbol: ENAM
• Synonyms: ENAM; enamelin; AIH2, amelogenesis imperfecta 2, hypocalcification (autosomal dominant); amelogenesis imperfecta 2, hypocalcification (autosomal dominant); ADAI; AI1C; AIH2
• Gene ID: 10117
• mRNA Refseq: NM_031889
• Protein Refseq: NP_114095
• MIM: 606585
• UniProt ID: Q9NRM1