Recombinant Human ENAM protein, His-tagged
| Cat.No. : | ENAM-4703H |
| Product Overview : | Recombinant Human ENAM protein(Q9NRM1)(1043-1142 aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1043-1142 aa |
| Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
| Molecular Mass : | 12.6 kDa |
| AASequence : | ERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQA |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
| Gene Name | ENAM enamelin [ Homo sapiens ] |
| Official Symbol | ENAM |
| Synonyms | ENAM; enamelin; AIH2, amelogenesis imperfecta 2, hypocalcification (autosomal dominant); amelogenesis imperfecta 2, hypocalcification (autosomal dominant); ADAI; AI1C; AIH2; |
| Gene ID | 10117 |
| mRNA Refseq | NM_031889 |
| Protein Refseq | NP_114095 |
| MIM | 606585 |
| UniProt ID | Q9NRM1 |
| ◆ Recombinant Proteins | ||
| ENAM-43H | Recombinant Human ENAM protein, GST-tagged | +Inquiry |
| ENAM-4703H | Recombinant Human ENAM protein, His-tagged | +Inquiry |
| ENAM-4580H | Recombinant Human ENAM protein, His-tagged | +Inquiry |
| ENAM-2786M | Recombinant Mouse ENAM Protein, His (Fc)-Avi-tagged | +Inquiry |
| ENAM-8755H | Recombinant Human ENAM protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENAM Products
Required fields are marked with *
My Review for All ENAM Products
Required fields are marked with *



