Recombinant Human ENAM protein, His-tagged

Cat.No. : ENAM-4703H
Product Overview : Recombinant Human ENAM protein(Q9NRM1)(1043-1142 aa), fused with C-terminal His tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1043-1142 aa
Form : For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
Molecular Mass : 12.6 kDa
AASequence : ERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQA
Purity : Greater than 95% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.
Gene Name ENAM enamelin [ Homo sapiens ]
Official Symbol ENAM
Synonyms ENAM; enamelin; AIH2, amelogenesis imperfecta 2, hypocalcification (autosomal dominant); amelogenesis imperfecta 2, hypocalcification (autosomal dominant); ADAI; AI1C; AIH2;
Gene ID 10117
mRNA Refseq NM_031889
Protein Refseq NP_114095
MIM 606585
UniProt ID Q9NRM1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ENAM Products

Required fields are marked with *

My Review for All ENAM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon