Recombinant Human ENAM protein, His-tagged

• Cat.No.: ENAM-8755H
• Product Overview: Recombinant Human ENAM protein(Q9NRM1)(1043-1142aa), fused with C-terminal His tag, was expressed in Insect cells.

Specification

• Species: Human
• Source: Insect cells
• Tag: His
• Protein Length: 1043-1142aa
• Tag: C-His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 12.4 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: ERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQA

Gene Information

• Gene Name: ENAM enamelin [ Homo sapiens ]
• Official Symbol: ENAM
• Synonyms: ENAM; enamelin; AIH2, amelogenesis imperfecta 2, hypocalcification (autosomal dominant); amelogenesis imperfecta 2, hypocalcification (autosomal dominant); ADAI; AI1C; AIH2
• Gene ID: 10117
• mRNA Refseq: NM_031889
• Protein Refseq: NP_114095
• MIM: 606585
• UniProt ID: Q9NRM1