Recombinant Human EOMES protein, GST-tagged
Cat.No. : | EOMES-301271H |
Product Overview : | Recombinant Human EOMES (575-676 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met575-Met676 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGM |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | EOMES eomesodermin [ Homo sapiens ] |
Official Symbol | EOMES |
Synonyms | EOMES; eomesodermin; eomesodermin (Xenopus laevis) homolog; eomesodermin homolog; T box brain2; TBR2; TBR-2; T-brain-2; T-box brain2; t box, brain, 2; T-box brain protein 2; |
Gene ID | 8320 |
mRNA Refseq | NM_005442 |
Protein Refseq | NP_005433 |
MIM | 604615 |
UniProt ID | O95936 |
◆ Recombinant Proteins | ||
EOMES-5228M | Recombinant Mouse EOMES Protein | +Inquiry |
EOMES-3344H | Recombinant Human EOMES Protein, GST-tagged | +Inquiry |
EOMES-3345H | Recombinant Human EOMES Protein, Myc/DDK-tagged | +Inquiry |
EOMES-301271H | Recombinant Human EOMES protein, GST-tagged | +Inquiry |
EOMES-389H | Recombinant Human EOMES Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EOMES-6589HCL | Recombinant Human EOMES 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EOMES Products
Required fields are marked with *
My Review for All EOMES Products
Required fields are marked with *