Recombinant Human EOMES Protein, GST-tagged
Cat.No. : | EOMES-3344H |
Product Overview : | Human EOMES partial ORF ( NP_005433, 547 a.a. - 645 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the TBR1 (T-box brain protein 1) sub-family of T-box genes that share the common DNA-binding T-box domain. The encoded protein is a transcription factor which is crucial for embryonic development of mesoderm and the central nervous system in vertebrates. The protein may also be necessary for the differentiation of effector CD8+ T cells which are involved in defense against viral infections. A similar gene disrupted in mice is shown to be essential during trophoblast development and gastrulation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | PYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTVFSEDQLSKEKVKEEIGSSWIETPPSIKSLDSNDSGVYTSACKRRRL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EOMES eomesodermin [ Homo sapiens ] |
Official Symbol | EOMES |
Synonyms | EOMES; eomesodermin; eomesodermin (Xenopus laevis) homolog; eomesodermin homolog; T box brain2; TBR2; TBR-2; T-brain-2; T-box brain2; t box, brain, 2; T-box brain protein 2; |
Gene ID | 8320 |
mRNA Refseq | NM_005442 |
Protein Refseq | NP_005433 |
MIM | 604615 |
UniProt ID | O95936 |
◆ Recombinant Proteins | ||
EOMES-5228M | Recombinant Mouse EOMES Protein | +Inquiry |
EOMES-1649H | Recombinant Human EOMES protein, His & GST-tagged | +Inquiry |
EOMES-389H | Recombinant Human EOMES Protein, His-tagged | +Inquiry |
EOMES-3345H | Recombinant Human EOMES Protein, Myc/DDK-tagged | +Inquiry |
EOMES-2807M | Recombinant Mouse EOMES Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EOMES-6589HCL | Recombinant Human EOMES 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EOMES Products
Required fields are marked with *
My Review for All EOMES Products
Required fields are marked with *