Recombinant Human EP300 Protein, His-tagged

• Cat.No.: EP300-85H
• Product Overview: Recombinant Human EP300 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. It functions as histone acetyltransferase that regulates transcription via chromatin remodeling and is important in the processes of cell proliferation and differentiation. It mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. This gene has also been identified as a co-activator of HIF1A (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as VEGF. Defects in this gene are a cause of Rubinstein-Taybi syndrome and may also play a role in epithelial cancer.
• Form: Supplied as a 0.2 μm filtered solution in 20mM Tris, 150mM NaCl (pH8.0).
• Molecular Mass: ~11.4 kDa
• AA Sequence: MGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKLEHHHHHH
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.26 mg/ml

Gene Information

• Gene Name: EP300 E1A binding protein p300 [ Homo sapiens (human) ]
• Official Symbol: EP300
• Synonyms: p300; KAT3B; MKHK2; RSTS2
• Gene ID: 2033
• mRNA Refseq: NM_001362843
• Protein Refseq: NP_001349772
• MIM: 602700
• UniProt ID: Q9Y6B2