Recombinant Human epidermal growth factor Protein, HA tagged
Cat.No. : | EGF-58H |
Product Overview : | Recombinant Human EGF Protein with C-HA and N-Glu-Ala was expressed in Yeast (animal free media and environment). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | HA |
Description : | This gene encodes a member of the epidermal growth factor superfamily. The encoded preproprotein is proteolytically processed to generate the 53-amino acid epidermal growth factor peptide. This protein acts a potent mitogenic factor that plays an important role in the growth, proliferation and differentiation of numerous cell types. This protein acts by binding with high affinity to the cell surface receptor, epidermal growth factor receptor. Defects in this gene are the cause of hypomagnesemia type 4. Dysregulation of this gene has been associated with the growth and progression of certain cancers. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. |
Tag : | C-HA; N-Glu-Ala |
Form : | Lyophilized |
Bio-activity : | The biological activity of Human Recombinant EGF was tested by its ability to promote the proliferation of BALB/c 3T3 cells. Cell proliferation was measured using a fluorometric assay method. The EC50 is defined as the effective concentration of the growth factor at which cell proliferation is at 50 % of maximum, which is < 0.1ng/ml |
Molecular Mass : | 7.4 kDa |
AA Sequence : | (EA)NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRYPYDVPDYA |
Endotoxin : | < 0.2 EU/μg of protein as determined by the LAL method. |
Purity : | 0.98 |
Storage : | Stable for at least one year at -20 centigrade. Upon reconstitution EGF can be stored at +4 centigrade for 2 weeks or at -20 centigrade for 6 months. |
Concentration : | 100 μg/μL |
Storage Buffer : | Phosphate -buffered saline (PBS), pH 7.4 |
Reconstitution : | Spin the vial briefly, add distilled sterile water. |
References : | 1. Harris, R.C. et al. (2003) Exp. Cell Res. 284: 2. Carpenter, G. and Cohen, S. (1990) J. Biol. Chem. 265:7709. |
Gene Name | EGF epidermal growth factor [Homo sapiens (human)] |
Official Symbol | EGF |
Synonyms | EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4 |
Gene ID | 1950 |
mRNA Refseq | NM_001178130 |
Protein Refseq | NP_001171601 |
MIM | 131530 |
UniProt ID | P01133 |
◆ Native Proteins | ||
Egf-635R | Native Rat Egf | +Inquiry |
Egf -635R | Native Rat Egf protein | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
EGF-26462TH | Native Human EGF | +Inquiry |
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGF Products
Required fields are marked with *
My Review for All EGF Products
Required fields are marked with *