Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ERCC2, His-tagged

Cat.No. : ERCC2-30131TH
Product Overview : Recombinant fragment, corresponding to amino acids 533-760 of Human XPD with an N terminal His tag. Predicted MWt: 27 kDa,
  • Specification
  • Gene Information
  • Related Products
Description : The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 137 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DGIVAFFTSYQYMESTVASWYEQGILENIQRNKLLFIETQ DGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDF VHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRE NDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGD KRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQ PFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL
Gene Name : ERCC2 excision repair cross-complementing rodent repair deficiency, complementation group 2 [ Homo sapiens ]
Official Symbol : ERCC2
Synonyms : ERCC2; excision repair cross-complementing rodent repair deficiency, complementation group 2; xeroderma pigmentosum complementary group D , XPD; TFIIH basal transcription factor complex helicase XPD subunit; EM9; excision repair cross complementing rodent
Gene ID : 2068
mRNA Refseq : NM_000400
Protein Refseq : NP_000391
MIM : 126340
Uniprot ID : P18074
Chromosome Location : 19q13.3
Pathway : Basal transcription factors, organism-specific biosystem; Basal transcription factors, conserved biosystem; DNA Repair, organism-specific biosystem; Dual incision reaction in GG-NER, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem;
Function : 5-3 DNA helicase activity; ATP binding; ATP-dependent DNA helicase activity; DNA binding; contributes_to DNA-dependent ATPase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends