Recombinant Human ERCC2, His-tagged

• Cat.No.: ERCC2-30131TH
• Product Overview: Recombinant fragment, corresponding to amino acids 533-760 of Human XPD with an N terminal His tag. Predicted MWt: 27 kDa,

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 533-760 a.a.
• Description: The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 137 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DGIVAFFTSYQYMESTVASWYEQGILENIQRNKLLFIETQ DGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDF VHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRE NDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGD KRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQ PFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL

Gene Information

• Gene Name: ERCC2 excision repair cross-complementing rodent repair deficiency, complementation group 2 [ Homo sapiens ]
• Official Symbol: ERCC2
• Synonyms: ERCC2; excision repair cross-complementing rodent repair deficiency, complementation group 2; xeroderma pigmentosum complementary group D , XPD; TFIIH basal transcription factor complex helicase XPD subunit; EM9; excision repair cross complementing rodent
• Gene ID: 2068
• mRNA Refseq: NM_000400
• Protein Refseq: NP_000391
• MIM: 126340
• Uniprot ID: P18074
• Chromosome Location: 19q13.3
• Pathway: Basal transcription factors, organism-specific biosystem; Basal transcription factors, conserved biosystem; DNA Repair, organism-specific biosystem; Dual incision reaction in GG-NER, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem
• Function: 5-3 DNA helicase activity; ATP binding; ATP-dependent DNA helicase activity; DNA binding; contributes_to DNA-dependent ATPase activity