Recombinant Human ERCC2, His-tagged

Cat.No. : ERCC2-30131TH
Product Overview : Recombinant fragment, corresponding to amino acids 533-760 of Human XPD with an N terminal His tag. Predicted MWt: 27 kDa,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 533-760 a.a.
Description : The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 137 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DGIVAFFTSYQYMESTVASWYEQGILENIQRNKLLFIETQ DGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDF VHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRE NDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGD KRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQ PFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL
Gene Name ERCC2 excision repair cross-complementing rodent repair deficiency, complementation group 2 [ Homo sapiens ]
Official Symbol ERCC2
Synonyms ERCC2; excision repair cross-complementing rodent repair deficiency, complementation group 2; xeroderma pigmentosum complementary group D , XPD; TFIIH basal transcription factor complex helicase XPD subunit; EM9; excision repair cross complementing rodent
Gene ID 2068
mRNA Refseq NM_000400
Protein Refseq NP_000391
MIM 126340
Uniprot ID P18074
Chromosome Location 19q13.3
Pathway Basal transcription factors, organism-specific biosystem; Basal transcription factors, conserved biosystem; DNA Repair, organism-specific biosystem; Dual incision reaction in GG-NER, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem;
Function 5-3 DNA helicase activity; ATP binding; ATP-dependent DNA helicase activity; DNA binding; contributes_to DNA-dependent ATPase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERCC2 Products

Required fields are marked with *

My Review for All ERCC2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon