Recombinant Human ERCC2, His-tagged
Cat.No. : | ERCC2-30131TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 533-760 of Human XPD with an N terminal His tag. Predicted MWt: 27 kDa, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 533-760 a.a. |
Description : | The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 137 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DGIVAFFTSYQYMESTVASWYEQGILENIQRNKLLFIETQ DGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDF VHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRE NDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGD KRGKLPRWIQEHLTDANLNLTVDEGVQVAKYFLRQMAQ PFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL |
Gene Name | ERCC2 excision repair cross-complementing rodent repair deficiency, complementation group 2 [ Homo sapiens ] |
Official Symbol | ERCC2 |
Synonyms | ERCC2; excision repair cross-complementing rodent repair deficiency, complementation group 2; xeroderma pigmentosum complementary group D , XPD; TFIIH basal transcription factor complex helicase XPD subunit; EM9; excision repair cross complementing rodent |
Gene ID | 2068 |
mRNA Refseq | NM_000400 |
Protein Refseq | NP_000391 |
MIM | 126340 |
Uniprot ID | P18074 |
Chromosome Location | 19q13.3 |
Pathway | Basal transcription factors, organism-specific biosystem; Basal transcription factors, conserved biosystem; DNA Repair, organism-specific biosystem; Dual incision reaction in GG-NER, organism-specific biosystem; Dual incision reaction in TC-NER, organism-specific biosystem; |
Function | 5-3 DNA helicase activity; ATP binding; ATP-dependent DNA helicase activity; DNA binding; contributes_to DNA-dependent ATPase activity; |
◆ Recombinant Proteins | ||
ERCC2-2397H | Recombinant Human ERCC2 Protein (Ala404-Leu637), N-His tagged | +Inquiry |
ERCC2-3457H | Recombinant Human ERCC2 Protein, GST-tagged | +Inquiry |
ERCC2-4548HF | Recombinant Full Length Human ERCC2 Protein, GST-tagged | +Inquiry |
ERCC2-5285M | Recombinant Mouse ERCC2 Protein | +Inquiry |
ERCC2-2842M | Recombinant Mouse ERCC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERCC2-6566HCL | Recombinant Human ERCC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERCC2 Products
Required fields are marked with *
My Review for All ERCC2 Products
Required fields are marked with *
0
Inquiry Basket