Recombinant Human EREG protein, His-SUMO-tagged
| Cat.No. : | EREG-2869H |
| Product Overview : | Recombinant Human EREG protein(O14944)(60-119aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 60-119aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 22.9 kDa |
| AA Sequence : | VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | EREG epiregulin [ Homo sapiens ] |
| Official Symbol | EREG |
| Synonyms | EREG; epiregulin; proepiregulin; ER; |
| Gene ID | 2069 |
| mRNA Refseq | NM_001432 |
| Protein Refseq | NP_001423 |
| MIM | 602061 |
| UniProt ID | O14944 |
| ◆ Recombinant Proteins | ||
| Ereg-576M | Active Recombinant Mouse Ereg, Fc tagged | +Inquiry |
| EREG-023H | Active Recombinant Human EREG Protein | +Inquiry |
| EREG-562H | Active Recombinant Human EREG protein(Val63-Leu108), hFc-tagged | +Inquiry |
| Ereg-595M | Active Recombinant Mouse Ereg | +Inquiry |
| EREG-2869H | Recombinant Human EREG protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EREG-1868HCL | Recombinant Human EREG cell lysate | +Inquiry |
| EREG-1871MCL | Recombinant Mouse EREG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EREG Products
Required fields are marked with *
My Review for All EREG Products
Required fields are marked with *
