Recombinant Human EREG protein, His-SUMO-tagged
Cat.No. : | EREG-2869H |
Product Overview : | Recombinant Human EREG protein(O14944)(60-119aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 60-119aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 22.9 kDa |
AA Sequence : | VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | EREG epiregulin [ Homo sapiens ] |
Official Symbol | EREG |
Synonyms | EREG; epiregulin; proepiregulin; ER; |
Gene ID | 2069 |
mRNA Refseq | NM_001432 |
Protein Refseq | NP_001423 |
MIM | 602061 |
UniProt ID | O14944 |
◆ Recombinant Proteins | ||
EREG-1438H | Recombinant Human EREG Protein, His-tagged | +Inquiry |
Ereg-198M | Recombinant Mouse Epiregulin | +Inquiry |
EREG-235H | Recombinant Human EREG protein | +Inquiry |
EREG-1077C | Recombinant Chicken EREG | +Inquiry |
EREG-2869H | Recombinant Human EREG protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EREG-1871MCL | Recombinant Mouse EREG cell lysate | +Inquiry |
EREG-1868HCL | Recombinant Human EREG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EREG Products
Required fields are marked with *
My Review for All EREG Products
Required fields are marked with *
0
Inquiry Basket