Recombinant Human ERH Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ERH-2364H |
| Product Overview : | ERH MS Standard C13 and N15-labeled recombinant protein (NP_004441) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | May have a role in the cell cycle. |
| Molecular Mass : | 12.3 kDa |
| AA Sequence : | MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ERH ERH mRNA splicing and mitosis factor [ Homo sapiens (human) ] |
| Official Symbol | ERH |
| Synonyms | ERH; enhancer of rudimentary homolog (Drosophila); enhancer of rudimentary (Drosophila) homolog; enhancer of rudimentary homolog; DROER; FLJ27340; |
| Gene ID | 2079 |
| mRNA Refseq | NM_004450 |
| Protein Refseq | NP_004441 |
| MIM | 601191 |
| UniProt ID | P84090 |
| ◆ Recombinant Proteins | ||
| ERH-1492R | Recombinant Rhesus monkey ERH Protein, His-tagged | +Inquiry |
| ERH-2420H | Recombinant Full Length Human ERH Protein, Flag tagged | +Inquiry |
| ERH-28693TH | Recombinant Human ERH, His-tagged | +Inquiry |
| ERH-12534H | Recombinant Human ERH, GST-tagged | +Inquiry |
| ERH-5299M | Recombinant Mouse ERH Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ERH-6555HCL | Recombinant Human ERH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ERH Products
Required fields are marked with *
My Review for All ERH Products
Required fields are marked with *



